NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F038530

Metagenome / Metatranscriptome Family F038530

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F038530
Family Type Metagenome / Metatranscriptome
Number of Sequences 165
Average Sequence Length 40 residues
Representative Sequence MRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPT
Number of Associated Samples 154
Number of Associated Scaffolds 165

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 98.18 %
% of genes from short scaffolds (< 2000 bps) 98.79 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.12

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.515 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil
(15.152 % of family members)
Environment Ontology (ENVO) Unclassified
(16.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.970 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.12
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.52 %
UnclassifiedrootN/A8.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008884|Ga0103746_10018914All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila818Open in IMG/M
3300009196|Ga0103745_10025097All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila815Open in IMG/M
3300009199|Ga0103748_10035059All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila819Open in IMG/M
3300009225|Ga0103851_1042390All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila749Open in IMG/M
3300009233|Ga0103856_10041863All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300009235|Ga0103857_10048965All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila800Open in IMG/M
3300009235|Ga0103857_10050003All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila793Open in IMG/M
3300009239|Ga0103858_10108433All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila698Open in IMG/M
3300009243|Ga0103860_10057731All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila782Open in IMG/M
3300009243|Ga0103860_10061420All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila762Open in IMG/M
3300009249|Ga0103862_1021342All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila825Open in IMG/M
3300009249|Ga0103862_1022679All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila806Open in IMG/M
3300009252|Ga0103863_10022081All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila777Open in IMG/M
3300009257|Ga0103869_10083742All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila774Open in IMG/M
3300009261|Ga0103870_1017361All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila832Open in IMG/M
3300009281|Ga0103744_10072696All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300009295|Ga0103747_10077264All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila832Open in IMG/M
3300009382|Ga0103866_1012493All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila782Open in IMG/M
3300010066|Ga0127427_105974All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila531Open in IMG/M
3300010071|Ga0127477_109814All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila793Open in IMG/M
3300010071|Ga0127477_126016All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila780Open in IMG/M
3300010087|Ga0127492_1089405All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila796Open in IMG/M
3300010092|Ga0127468_1002273All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila675Open in IMG/M
3300010103|Ga0127500_1035253All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila698Open in IMG/M
3300010112|Ga0127458_1123763All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila783Open in IMG/M
3300010115|Ga0127495_1102111All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila593Open in IMG/M
3300010117|Ga0127449_1014703All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila795Open in IMG/M
3300010117|Ga0127449_1079942All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila769Open in IMG/M
3300010118|Ga0127465_1082563All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila791Open in IMG/M
3300010119|Ga0127452_1069599All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300010132|Ga0127455_1093467All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila764Open in IMG/M
3300010141|Ga0127499_1076487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila673Open in IMG/M
3300010144|Ga0115593_1011358All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila794Open in IMG/M
3300010147|Ga0126319_1594453All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila697Open in IMG/M
3300010371|Ga0134125_11576798All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila715Open in IMG/M
3300010399|Ga0134127_13327726All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila526Open in IMG/M
3300010860|Ga0126351_1114451All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila730Open in IMG/M
3300010869|Ga0126359_1655841All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila821Open in IMG/M
3300011045|Ga0138598_106787All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila505Open in IMG/M
3300011054|Ga0138523_1049255All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila741Open in IMG/M
3300011332|Ga0126317_10650020All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila809Open in IMG/M
3300011340|Ga0151652_11190252All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila707Open in IMG/M
3300011433|Ga0137443_1123142All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila756Open in IMG/M
3300012375|Ga0134034_1173459All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila831Open in IMG/M
3300012377|Ga0134029_1106567Not Available564Open in IMG/M
3300012379|Ga0134058_1162869All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila818Open in IMG/M
3300012381|Ga0134026_1064062All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila716Open in IMG/M
3300012386|Ga0134046_1153899All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila680Open in IMG/M
3300012388|Ga0134031_1187927All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila546Open in IMG/M
3300012389|Ga0134040_1257008All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila690Open in IMG/M
3300012396|Ga0134057_1225586All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila523Open in IMG/M
3300012397|Ga0134056_1185813All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300012401|Ga0134055_1092522All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila538Open in IMG/M
3300012410|Ga0134060_1175388All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila799Open in IMG/M
3300012469|Ga0150984_100983618All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300012683|Ga0137398_10797313All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila660Open in IMG/M
3300012756|Ga0138272_1186733All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila794Open in IMG/M
3300013295|Ga0170791_12602487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila695Open in IMG/M
3300015250|Ga0180072_1095035All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila528Open in IMG/M
3300019165|Ga0184589_113834Not Available763Open in IMG/M
3300019178|Ga0184583_101767Not Available806Open in IMG/M
3300019200|Ga0180036_1033186All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila683Open in IMG/M
3300019201|Ga0180032_1043994All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila770Open in IMG/M
3300019201|Ga0180032_1129687All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila804Open in IMG/M
3300019202|Ga0179947_1129592All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila792Open in IMG/M
3300019207|Ga0180034_1024333All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300019212|Ga0180106_1039333All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila797Open in IMG/M
3300019222|Ga0179957_1122075All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila790Open in IMG/M
3300019240|Ga0181510_1011194All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia809Open in IMG/M
3300019244|Ga0180111_1057911All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila516Open in IMG/M
3300019245|Ga0187791_1148272All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila750Open in IMG/M
3300019245|Ga0187791_1423134All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila710Open in IMG/M
3300019250|Ga0187790_1011510All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila819Open in IMG/M
3300019265|Ga0187792_1075397All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila716Open in IMG/M
3300019279|Ga0184642_1371599All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila792Open in IMG/M
3300020076|Ga0206355_1505059All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila775Open in IMG/M
3300020081|Ga0206354_10064934All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila795Open in IMG/M
3300020610|Ga0154015_1354900All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300021273|Ga0210340_1001444All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila794Open in IMG/M
3300021282|Ga0210303_1089103All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila804Open in IMG/M
3300021283|Ga0210357_1063716All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila705Open in IMG/M
3300021307|Ga0179585_1053491All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila780Open in IMG/M
3300021336|Ga0210307_1394540All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila794Open in IMG/M
3300021859|Ga0210334_10213364All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila738Open in IMG/M
3300021861|Ga0213853_10447056All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila797Open in IMG/M
3300021909|Ga0213846_1048670All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila670Open in IMG/M
3300021909|Ga0213846_1066248All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300021951|Ga0222624_1304571All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila800Open in IMG/M
3300021967|Ga0213848_1015798All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila513Open in IMG/M
3300022154|Ga0213929_1011517All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila791Open in IMG/M
3300022166|Ga0213932_1046789All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila633Open in IMG/M
3300022195|Ga0222625_1440399All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila793Open in IMG/M
3300022195|Ga0222625_1633124All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila802Open in IMG/M
3300022372|Ga0210293_114247All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila794Open in IMG/M
3300022498|Ga0242644_1012192All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila786Open in IMG/M
3300022499|Ga0242641_1004254All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1084Open in IMG/M
3300022499|Ga0242641_1038912All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila546Open in IMG/M
3300022501|Ga0242645_1008110All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila794Open in IMG/M
3300022501|Ga0242645_1008192All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila791Open in IMG/M
3300022507|Ga0222729_1018721All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila802Open in IMG/M
3300022510|Ga0242652_1013095All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila816Open in IMG/M
3300022511|Ga0242651_1021547All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila679Open in IMG/M
3300022523|Ga0242663_1015751All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1082Open in IMG/M
3300022525|Ga0242656_1100135All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila567Open in IMG/M
3300022529|Ga0242668_1037375All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila818Open in IMG/M
3300022531|Ga0242660_1071281All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300022708|Ga0242670_1018774All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300022711|Ga0242674_1022145All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila750Open in IMG/M
3300022714|Ga0242671_1030366Not Available813Open in IMG/M
3300022726|Ga0242654_10137583All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila804Open in IMG/M
3300023553|Ga0247524_115258Not Available519Open in IMG/M
3300023691|Ga0228704_107471All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila844Open in IMG/M
3300024480|Ga0255223_1032332All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila876Open in IMG/M
3300024484|Ga0256332_1129146All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila541Open in IMG/M
3300024487|Ga0255222_1040460All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila697Open in IMG/M
3300024547|Ga0255292_1055256All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila780Open in IMG/M
3300024557|Ga0255283_1064211All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300024566|Ga0256309_1116049All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila668Open in IMG/M
3300024849|Ga0255230_1041196All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila835Open in IMG/M
3300024865|Ga0256340_1120778All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila634Open in IMG/M
3300024957|Ga0208121_117899All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila857Open in IMG/M
3300025679|Ga0207933_1191145All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila574Open in IMG/M
3300025763|Ga0255250_1132901All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila535Open in IMG/M
3300026435|Ga0256297_1031686All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila820Open in IMG/M
3300026567|Ga0256303_1082892All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila682Open in IMG/M
3300026568|Ga0255240_1056525All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila891Open in IMG/M
3300028619|Ga0257136_1045338All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila794Open in IMG/M
3300028647|Ga0272412_1206191All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300028650|Ga0302170_10184046All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila533Open in IMG/M
3300029687|Ga0265602_1032731All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila697Open in IMG/M
3300029697|Ga0256301_1050397All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila712Open in IMG/M
3300029699|Ga0255233_1078900All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila652Open in IMG/M
3300029923|Ga0311347_10540521All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila708Open in IMG/M
3300030114|Ga0311333_11736490All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila541Open in IMG/M
3300030594|Ga0210280_1024848Not Available863Open in IMG/M
3300030630|Ga0210282_10216277Not Available630Open in IMG/M
3300030631|Ga0210279_10113300Not Available845Open in IMG/M
3300030777|Ga0075402_10087952All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila686Open in IMG/M
3300030812|Ga0265734_105686All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila546Open in IMG/M
3300030816|Ga0265729_101995All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila674Open in IMG/M
3300030836|Ga0265767_102584Not Available981Open in IMG/M
3300030845|Ga0075397_10048594All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila684Open in IMG/M
3300030888|Ga0265769_105041All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila793Open in IMG/M
3300030903|Ga0308206_1070115All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila736Open in IMG/M
3300030904|Ga0308198_1035909All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila726Open in IMG/M
3300030917|Ga0075382_10050917All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila521Open in IMG/M
3300030941|Ga0265737_103826All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila791Open in IMG/M
3300030970|Ga0075381_11557219All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila541Open in IMG/M
3300030971|Ga0075375_10105665All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila710Open in IMG/M
3300030988|Ga0308183_1053186All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila819Open in IMG/M
3300031240|Ga0265320_10193648All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila908Open in IMG/M
3300031493|Ga0314826_114744All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila787Open in IMG/M
3300031503|Ga0314820_104994All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila792Open in IMG/M
3300031663|Ga0307484_104654All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila817Open in IMG/M
3300033527|Ga0316586_1044131All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila789Open in IMG/M
3300033529|Ga0316587_1042969All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila819Open in IMG/M
3300034194|Ga0370499_0074024All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila829Open in IMG/M
3300034659|Ga0314780_069796Not Available746Open in IMG/M
3300034667|Ga0314792_069138Not Available820Open in IMG/M
3300034671|Ga0314796_048870All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300034672|Ga0314797_045835Not Available781Open in IMG/M
3300034673|Ga0314798_159035All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila521Open in IMG/M
3300034675|Ga0314800_074870All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila520Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil15.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.55%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater8.48%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water7.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.67%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.06%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.64%
Wastewater SludgeEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge3.03%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds2.42%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.42%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.42%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.82%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.82%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.21%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.21%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.21%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.21%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.21%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.21%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge1.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.61%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.61%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.61%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.61%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.61%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.61%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.61%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008884Microbial communities of wastewater sludge from Singapore - Sludge3_b2_FebruaryEnvironmentalOpen in IMG/M
3300009196Microbial communities of wastewater sludge from Singapore - Sludge1_b2_FebruaryEnvironmentalOpen in IMG/M
3300009199Microbial communities of wastewater sludge from Singapore - Sludge7_b2_FebruaryEnvironmentalOpen in IMG/M
3300009225Microbial communities of water from Amazon river, Brazil - RCM4EnvironmentalOpen in IMG/M
3300009233Microbial communities of water from Amazon river, Brazil - RCM9EnvironmentalOpen in IMG/M
3300009235Microbial communities of water from Amazon river, Brazil - RCM10EnvironmentalOpen in IMG/M
3300009239Microbial communities of water from Amazon river, Brazil - RCM11EnvironmentalOpen in IMG/M
3300009243Microbial communities of water from Amazon river, Brazil - RCM13EnvironmentalOpen in IMG/M
3300009249Microbial communities of water from Amazon river, Brazil - RCM15EnvironmentalOpen in IMG/M
3300009252Microbial communities of water from Amazon river, Brazil - RCM16EnvironmentalOpen in IMG/M
3300009257Microbial communities of water from Amazon river, Brazil - RCM22EnvironmentalOpen in IMG/M
3300009261Microbial communities of water from Amazon river, Brazil - RCM23EnvironmentalOpen in IMG/M
3300009281Microbial communities of wastewater sludge from Singapore - Sludge_b1_OctoberEnvironmentalOpen in IMG/M
3300009295Microbial communities of wastewater sludge from Singapore - Sludge5_b2_FebruaryEnvironmentalOpen in IMG/M
3300009382Microbial communities of water from Amazon river, Brazil - RCM19EnvironmentalOpen in IMG/M
3300010066Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010071Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010087Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010092Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010103Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010112Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010115Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010118Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010119Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010132Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010141Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010144Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011045Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011054Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300012375Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012377Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012379Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012381Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012388Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012396Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300015250Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293B_16_10DEnvironmentalOpen in IMG/M
3300019165Soil microbial communities from Bohemian Forest, Czech Republic ? CSA1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019178Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019202Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA5_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019207Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019212Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019222Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019244Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019245Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019250Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019265Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021273Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021282Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021283Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.587 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021307Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021909Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - NH:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021967Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022154Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022166Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022372Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022498Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022499Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022501Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022511Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022525Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023553Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023691Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024480Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024484Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024487Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024547Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024557Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024566Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024849Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024865Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024957Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 62_LOW9 (SPAdes)EnvironmentalOpen in IMG/M
3300025679Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025763Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026435Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026567Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026568Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300028619Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028647Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300028650Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_1EnvironmentalOpen in IMG/M
3300029687Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_36m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029697Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029699Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030812Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030816Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030836Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030845Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030888Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030917Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030941Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030970Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030971Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031493Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031503Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031663Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300033527Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033529Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300034194Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034667Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034671Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034673Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034675Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103746_1001891423300008884Wastewater SludgeMRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTSDFGPG
Ga0103745_1002509723300009196Wastewater SludgeMRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTSELGI
Ga0103748_1003505923300009199Wastewater SludgeMRPTAAHAAWSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPG
Ga0103851_104239013300009225River WaterMRPTASHAAMSSVGKHTARESEAPNAVRMGKSAWRAP
Ga0103856_1004186313300009233River WaterMRPTASHAAMSSVGKHPARESEAPNAMRMEKSAWRAPTSDKKK
Ga0103857_1004896513300009235River WaterMRPTASHAAMSSVGKHPARESEAPNAMRMEKSAWRAPTSDF
Ga0103857_1005000313300009235River WaterMRPRPSHAAVSSVGEHTARESEAPNVVRMGKSAWRAPTPDFGPGAARFP
Ga0103858_1010843313300009239River WaterMRPRPSHAAVSSVGEHTARESEAPNDVRMGKSAWRAPTPDFGPGAARFP
Ga0103860_1005773113300009243River WaterMRPTASLAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDKK
Ga0103860_1006142023300009243River WaterMRPRASLAAKSSVGKHTARESEAPNVVRMGKSAWRAPT
Ga0103862_102134213300009249River WaterMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGPGSARS
Ga0103862_102267913300009249River WaterMRPRPSHAAVSSVGEHTARESEAPNAVPMGKSAWRAPTPDFGPGAARFP
Ga0103863_1002208113300009252River WaterMRPTASLAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDK
Ga0103869_1008374213300009257River WaterMRPRASHAAVSSVGKHTARESEAPNVVRMGKSAWR
Ga0103870_101736113300009261River WaterMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGPGSARSPG
Ga0103744_1007269623300009281Wastewater SludgeMRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTPDF
Ga0103747_1007726423300009295Wastewater SludgeMRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTSDKPGAQRKR
Ga0103866_101249313300009382River WaterMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDKKK
Ga0127427_10597423300010066Grasslands SoilMRPIASHAAMSSVGKHTARESEAPNVVRMGKSAWRA
Ga0127477_10981423300010071Grasslands SoilMRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRA
Ga0127477_12601613300010071Grasslands SoilMRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWRAPTP
Ga0127492_108940513300010087Grasslands SoilMRPTPSHAAVSSVGKHTARESEAPNVVRMGKSAWRA
Ga0127468_100227323300010092Grasslands SoilMRPIASHAAMSSVGKHTARESEAPNVVRMGKSAWR
Ga0127500_103525313300010103Grasslands SoilMRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWRAP
Ga0127458_112376323300010112Grasslands SoilMRPTPSHAAVSSVGKHTARESEAPNAVRMEKSAWR
Ga0127495_110211113300010115Grasslands SoilMRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWR
Ga0127449_101470323300010117Grasslands SoilMRPTAAHAALSSVGKHPARESEAPNVMRMGKSAWR
Ga0127449_107994223300010117Grasslands SoilMRPIASHAAMSSVGKHTARESEAPNVVRMVKSAWRAPT
Ga0127465_108256323300010118Grasslands SoilMRPTAAHAALSSVGKHPARESEAPNAMRMEKSAWRA
Ga0127452_106959913300010119Grasslands SoilMRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWRAPT
Ga0127455_109346713300010132Grasslands SoilMRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAP
Ga0127499_107648713300010141Grasslands SoilMRPTPSHAAVSSVGKHTARESEAPNVVRMEKSAWR
Ga0115593_101135823300010144WetlandMRPRAAHAAQSSVGEHTARESEAPNVVRLGKSAWRAP
Ga0126319_159445313300010147SoilMRPITSHAAVSGVGKHTARESEAPNVVRMGKSAWRAPTPAMRPR
Ga0134125_1157679813300010371Terrestrial SoilMRSITSHAAMSGVGKHTARESEAPNVVRMGKSAWRAPTPDFGPG
Ga0134127_1332772613300010399Terrestrial SoilMRPTASHAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPEFGPDPARGPG
Ga0126351_111445113300010860Boreal Forest SoilMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGP
Ga0126359_165584113300010869Boreal Forest SoilMRPRAAHAALSGVGEHTARESERAQCVPMGKSAWRAPTPKF
Ga0126350_1078276823300010880Boreal Forest SoilMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGPGSARSPGLY
Ga0138598_10678713300011045Peatlands SoilMRPTAAHAALSSVGKHPARESEAPNAMRMEKSAWRAPTS
Ga0138523_104925513300011054Peatlands SoilMRPIASHAAMSSVGKHTARESEAPNVVRMGKSAWRAPT
Ga0126317_1065002013300011332SoilMRPRASLAARSSVGKHTARESEAPNVVRMGKSAWRAPTPAAM
Ga0151652_1119025223300011340WetlandMRPRASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPTP
Ga0137443_112314213300011433SoilMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAP
Ga0134034_117345913300012375Grasslands SoilMRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPEFGPE
Ga0134029_110656713300012377Grasslands SoilMRPKSAHAALSGVGEHTARESERAQCVPMGKSAWRAPTPKFD
Ga0134058_116286913300012379Grasslands SoilMRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWRAPTPTPSAD
Ga0134026_106406213300012381Grasslands SoilMRPTSAHAALSSVGKHPARESEAPNAMRMEKSAWRAPTSDFGP
Ga0134046_115389913300012386Grasslands SoilMRPKASHAAVSGVGKHTARESEAPNAVRMGKSAWRAPT
Ga0134031_118792713300012388Grasslands SoilMRPTSAHAALSSVGKHPARESEAPNAMRMEKSAWRA
Ga0134040_125700823300012389Grasslands SoilMRPTASHAAVSSVGKHTARESEAPNVVRMEKSAWRAPTSDF
Ga0134057_122558613300012396Grasslands SoilMRPIAPLAAVSGVGKHTARESEAPNDVRMGKSAWRAP
Ga0134056_118581313300012397Grasslands SoilMRPIASHAAMSGVGKHTARESEAPNVVRMGKTAWRAPT
Ga0134055_109252213300012401Grasslands SoilMRPIASLAAMSGVGKHTARESEAPNDVRMGKTAWRAP
Ga0134060_117538823300012410Grasslands SoilMRPIAPLAAVSGVGKHTARESEAPNDVRMGKSAWRAPT
Ga0150984_10098361823300012469Avena Fatua RhizosphereMRPRASLAAKSSVGKHTARESEAPNAVRMGKSAWRAPTP
Ga0137398_1079731323300012683Vadose Zone SoilMRPRASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPTPDFGPGIARCP
Ga0138272_118673323300012756Freshwater LakeMRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWR
Ga0170791_1260248723300013295FreshwaterMRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPTP
Ga0180072_109503513300015250SoilMRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGTARCPGL
Ga0184589_11383413300019165SoilMRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEF
Ga0184583_10176723300019178SoilMRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFG
Ga0180036_103318613300019200EstuarineMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTP
Ga0180032_104399423300019201EstuarineMRPKAALAAQSGVGEHTARESEAPNVVRLGKSAWRAPTP
Ga0180032_112968713300019201EstuarineMRPRPSHAAVSSVGEHTARESEAPNDVPMGKSAWRAPTP
Ga0179947_112959223300019202Anaerobic Digestor SludgeMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRA
Ga0180034_102433313300019207EstuarineMRPKAALAAQSGVGEHTARESEAPNVVRLGKSAWRAP
Ga0180106_103933323300019212Groundwater SedimentMRPKASHAAKSSVGKHTARESEAPNVVRMGKSAWRAP
Ga0179957_112207513300019222Anaerobic Digestor SludgeMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWR
Ga0181510_101119423300019240PeatlandMRSRTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTP
Ga0180111_105791123300019244Groundwater SedimentMRPKASHAAVSSVGKHTARESEAPNVVRMGKSAWR
Ga0187791_114827223300019245PeatlandMRPKASHAAVSGVGKHTARESEAPNAVRMGKSAWRAPTP
Ga0187791_142313413300019245PeatlandMRSRASLAAESGVGEHTARESESAQCVRLGKSAWRAPT
Ga0187790_101151013300019250PeatlandMRSRASLAAESGVGEHTARESESAQCVRLGKSAWRAPTP
Ga0187792_107539713300019265PeatlandMRPTASHAAVSGVGKHTARESEAPNAVRMGKSAWRA
Ga0184642_137159913300019279Groundwater SedimentMRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRA
Ga0206355_150505923300020076Corn, Switchgrass And Miscanthus RhizosphereMRPIASHAAMSSVGKHTARESEAPNVVRKGKSAWRA
Ga0206354_1006493413300020081Corn, Switchgrass And Miscanthus RhizosphereMRPIASHAAMSSVGKHTARESEAPNVVRKGKSAWR
Ga0154015_135490013300020610Corn, Switchgrass And Miscanthus RhizosphereMRPIASHAAMSSVGKHTARESEAPNVVRKGKSAWRAPT
Ga0210340_100144413300021273EstuarineMRPRPSHAAVSSVGEHTARESEAPNDVPMGKSAWRA
Ga0210303_108910313300021282EstuarineMRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWRAPTP
Ga0210357_106371613300021283EstuarineMRPTASHAAVSSVGKHTARESEAPNVVRKGKSAWRAPTP
Ga0179585_105349123300021307Vadose Zone SoilMRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAP
Ga0210307_139454013300021336EstuarineMRPIASHAAVSSVGKHTARESEAPNVVRMGKSAWRA
Ga0210334_1021336413300021859EstuarineMRPTASHAAVSSVGKHTARESEAPNVVRKGKSAWRAPTPDFGPGAARLPG
Ga0213853_1044705613300021861WatershedsMRPTASHAAVSSVGKHTARESEAPNAVRMGKSTWRVPT
Ga0213846_104867013300021909WatershedsMRPIAPLAAVSGVGKHTARESEAPNDVRMGKSAWRAPTP
Ga0213846_106624823300021909WatershedsMRPTAAHAALSSVGKHPARESEAPNAMRMEKSAWRAPTSD
Ga0222624_130457113300021951Groundwater SedimentMRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTP
Ga0213848_101579823300021967WatershedsMRPRASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTP
Ga0213929_101151723300022154FreshwaterMRPTASHAAVSSVGEHTARESESAQCVRLGKCATG
Ga0213932_104678913300022166FreshwaterMRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTP
Ga0222625_144039913300022195Groundwater SedimentMRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWR
Ga0222625_163312413300022195Groundwater SedimentMRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPT
Ga0210293_11424713300022372EstuarineMRPTASHAAVSSVGKHTARESEAPNVVRKGKSAWRAPTPD
Ga0242644_101219223300022498SoilMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAP
Ga0242641_100425423300022499SoilMRPIASHAAMSSVGKHTARESEAPNAVRMGKSAWRAP
Ga0242641_103891223300022499SoilMRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWRAP
Ga0242645_100811013300022501SoilMRSTASLAAVSGVGKHTARESEAPNAVRMGKSAWRAP
Ga0242645_100819223300022501SoilMRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWRA
Ga0222729_101872123300022507SoilMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPT
Ga0242652_101309513300022510SoilMRPIPSHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSEGRD
Ga0242651_102154723300022511SoilMRPRASLAAMSSVGKHTARESEAPNVVRLGKSAWR
Ga0242663_101575113300022523SoilMRPRASLAAKSSVGKHTARESEAPNVVRMGKSAWRA
Ga0242656_110013513300022525SoilMRPIASHAAMSSVGKHTARESEAPNAVRMGKSAWRA
Ga0242668_103737523300022529SoilMRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTS
Ga0242660_107128133300022531SoilMRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWRAPT
Ga0242670_101877413300022708SoilMRPTSSHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTP
Ga0242674_102214513300022711SoilMRSTASLAAVSGVGKHTARESEAPNVVRMGKSAWRAPTPSN
Ga0242671_103036613300022714SoilMRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFGP
Ga0242654_1013758313300022726SoilMRPRASLAAKSSVGKHTARESEAPNVVRMGKSAWRAPTP
Ga0247524_11525813300023553SoilMRPTTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTP
Ga0228704_10747123300023691FreshwaterMRPKASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGPGSARSPGLNL
Ga0255223_103233213300024480FreshwaterMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDF
Ga0256332_112914613300024484FreshwaterMRPTAAHAAWSSVGEHTARESEAPNVVRMGKSAWR
Ga0255222_104046013300024487FreshwaterMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGP
Ga0255292_105525613300024547FreshwaterMRPRSSHAAVSSVGEHTARESEAPNVVRMGKSAWRAPTP
Ga0255283_106421113300024557FreshwaterMRPRSSHAAVSGVGEHTARESEAPNVVRMGKSAWRAP
Ga0256309_111604913300024566FreshwaterMRPRPSHAAVSSVGEHTARESEAPNDVPMGKSAWRAPT
Ga0255230_104119613300024849FreshwaterMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPG
Ga0256340_112077813300024865FreshwaterMRPRSSHAAVSGVGEHTARESEAPNVVRMGKSAWRA
Ga0208121_11789913300024957Freshwater SedimentMRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTSDFGPGSARSP
Ga0207933_119114513300025679Arctic Peat SoilMRPIASHAAVSSVGKHTARESEAPNVVRKGKSVWRAPTPDFGPG
Ga0255250_113290113300025763FreshwaterMRPTASHAAMSSVGKHTARESEAPNAVRMEKSAWR
Ga0256297_103168613300026435FreshwaterMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPV
Ga0256303_108289213300026567FreshwaterMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPT
Ga0255240_105652513300026568FreshwaterMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGT
Ga0208960_106239913300027649Freshwater LenticMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGTARCPGLY
Ga0257136_104533813300028619MarineMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWR
Ga0272412_120619113300028647Activated SludgeMRPTAAHAAWSSVGKHTARESEAPNAVRMGKSAWRAPTPD
Ga0302170_1018404613300028650FenMRPTASHAAMSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPG
Ga0265602_103273123300029687MarineMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFG
Ga0256301_105039713300029697FreshwaterMRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGTEVE
Ga0255233_107890033300029699FreshwaterMRPRPSHAAVSSVGEHTARESEAPNDVPMGKSAWR
Ga0311347_1054052123300029923FenMRSIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDLGPGTARCPGFYLSR
Ga0311333_1173649013300030114FenMRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGT
Ga0210280_102484813300030594SoilMRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFEREKEK
Ga0210282_1021627713300030630SoilMRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEKKRNEK
Ga0210279_1011330013300030631SoilMRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFGPGTARF
Ga0075402_1008795213300030777SoilMRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPE
Ga0265734_10568623300030812SoilMRPIASHAAMSSVGKHTARESEAPNVVRMGKSAWRAP
Ga0265729_10199513300030816SoilMRPIASHAAVSSVGKHTARESEAPNVVRKGKSAWRAP
Ga0265767_10258423300030836SoilMRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFGPGTA
Ga0075397_1004859413300030845SoilMRPTASHAAVSSVGKHPARESEAPNVVRMEKSAWRAPT
Ga0265769_10504113300030888SoilMRSIASLAAVSGVGKHTARESEAPNVVRMGKSAWRAP
Ga0308206_107011513300030903SoilMRPTASHAAMSSVGKHTARESEAPNAVRMGKSAWRA
Ga0308198_103590923300030904SoilMRPTASHAAMSSVGKHPARESEAPNAMRMEKSAWR
Ga0075382_1005091713300030917SoilMRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPK
Ga0265737_10382613300030941SoilMRPIASHAAVSSVGKHTARESEAPNVVRKGKSAWRAPTP
Ga0075381_1155721913300030970SoilMRPTASHAAVSSVGKHPARESEAPNVVRMEKSAWRAPTS
Ga0075375_1010566513300030971SoilMRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPEKEQ
Ga0308183_105318623300030988SoilMRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPEFGPNL
Ga0265320_1019364813300031240RhizosphereMRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFG
Ga0314826_11474413300031493SoilMRPIASHAAVSSVGKHTARESEAPNVVRMGKSAWR
Ga0314820_10499413300031503SoilMRPTASHAAMSSVGKHTARESEAPNSVPLGKSAWR
Ga0307484_10465423300031663Hardwood Forest SoilMRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPGRRGL
Ga0316586_104413123300033527RhizosphereMRPRASLAAVSSVGKHTARESEAPNAVRMGKSAWR
Ga0316587_104296913300033529RhizosphereMRPRAPLAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDAEKP
Ga0370499_0074024_3_1373300034194Untreated Peat SoilMRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPTPDFGPGT
Ga0314780_069796_634_7443300034659SoilMRPKHPHAAESGVGEHTARESEAPNVVRLGKSAWRAP
Ga0314792_069138_703_8193300034667SoilMRPKHPHAAESGVGEHTARESEAPNVVPLGKSAWRAPTP
Ga0314796_048870_687_8003300034671SoilMRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPT
Ga0314797_045835_1_1143300034672SoilMRPKHPHAAESGVGEHTARESEAPNVVRLGKSAWRAPT
Ga0314798_159035_2_1183300034673SoilMRPIAAHAALSSVGKHPARESEAPNAMRMGKSAWRAPTP
Ga0314800_074870_389_5203300034675SoilMRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDRRAN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.