Basic Information | |
---|---|
Family ID | F038530 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 165 |
Average Sequence Length | 40 residues |
Representative Sequence | MRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPT |
Number of Associated Samples | 154 |
Number of Associated Scaffolds | 165 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 98.18 % |
% of genes from short scaffolds (< 2000 bps) | 98.79 % |
Associated GOLD sequencing projects | 154 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.12 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.515 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (15.152 % of family members) |
Environment Ontology (ENVO) | Unclassified (16.364 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.970 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.12 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.52 % |
Unclassified | root | N/A | 8.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300008884|Ga0103746_10018914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300009196|Ga0103745_10025097 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300009199|Ga0103748_10035059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
3300009225|Ga0103851_1042390 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 749 | Open in IMG/M |
3300009233|Ga0103856_10041863 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300009235|Ga0103857_10048965 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
3300009235|Ga0103857_10050003 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 793 | Open in IMG/M |
3300009239|Ga0103858_10108433 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 698 | Open in IMG/M |
3300009243|Ga0103860_10057731 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 782 | Open in IMG/M |
3300009243|Ga0103860_10061420 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 762 | Open in IMG/M |
3300009249|Ga0103862_1021342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 825 | Open in IMG/M |
3300009249|Ga0103862_1022679 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300009252|Ga0103863_10022081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 777 | Open in IMG/M |
3300009257|Ga0103869_10083742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 774 | Open in IMG/M |
3300009261|Ga0103870_1017361 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 832 | Open in IMG/M |
3300009281|Ga0103744_10072696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300009295|Ga0103747_10077264 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 832 | Open in IMG/M |
3300009382|Ga0103866_1012493 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 782 | Open in IMG/M |
3300010066|Ga0127427_105974 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 531 | Open in IMG/M |
3300010071|Ga0127477_109814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 793 | Open in IMG/M |
3300010071|Ga0127477_126016 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 780 | Open in IMG/M |
3300010087|Ga0127492_1089405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 796 | Open in IMG/M |
3300010092|Ga0127468_1002273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 675 | Open in IMG/M |
3300010103|Ga0127500_1035253 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 698 | Open in IMG/M |
3300010112|Ga0127458_1123763 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 783 | Open in IMG/M |
3300010115|Ga0127495_1102111 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 593 | Open in IMG/M |
3300010117|Ga0127449_1014703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 795 | Open in IMG/M |
3300010117|Ga0127449_1079942 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 769 | Open in IMG/M |
3300010118|Ga0127465_1082563 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
3300010119|Ga0127452_1069599 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300010132|Ga0127455_1093467 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 764 | Open in IMG/M |
3300010141|Ga0127499_1076487 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 673 | Open in IMG/M |
3300010144|Ga0115593_1011358 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
3300010147|Ga0126319_1594453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 697 | Open in IMG/M |
3300010371|Ga0134125_11576798 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 715 | Open in IMG/M |
3300010399|Ga0134127_13327726 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 526 | Open in IMG/M |
3300010860|Ga0126351_1114451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 730 | Open in IMG/M |
3300010869|Ga0126359_1655841 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 821 | Open in IMG/M |
3300011045|Ga0138598_106787 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 505 | Open in IMG/M |
3300011054|Ga0138523_1049255 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 741 | Open in IMG/M |
3300011332|Ga0126317_10650020 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300011340|Ga0151652_11190252 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 707 | Open in IMG/M |
3300011433|Ga0137443_1123142 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 756 | Open in IMG/M |
3300012375|Ga0134034_1173459 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 831 | Open in IMG/M |
3300012377|Ga0134029_1106567 | Not Available | 564 | Open in IMG/M |
3300012379|Ga0134058_1162869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300012381|Ga0134026_1064062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 716 | Open in IMG/M |
3300012386|Ga0134046_1153899 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 680 | Open in IMG/M |
3300012388|Ga0134031_1187927 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 546 | Open in IMG/M |
3300012389|Ga0134040_1257008 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 690 | Open in IMG/M |
3300012396|Ga0134057_1225586 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 523 | Open in IMG/M |
3300012397|Ga0134056_1185813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300012401|Ga0134055_1092522 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 538 | Open in IMG/M |
3300012410|Ga0134060_1175388 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
3300012469|Ga0150984_100983618 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300012683|Ga0137398_10797313 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 660 | Open in IMG/M |
3300012756|Ga0138272_1186733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
3300013295|Ga0170791_12602487 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 695 | Open in IMG/M |
3300015250|Ga0180072_1095035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 528 | Open in IMG/M |
3300019165|Ga0184589_113834 | Not Available | 763 | Open in IMG/M |
3300019178|Ga0184583_101767 | Not Available | 806 | Open in IMG/M |
3300019200|Ga0180036_1033186 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 683 | Open in IMG/M |
3300019201|Ga0180032_1043994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 770 | Open in IMG/M |
3300019201|Ga0180032_1129687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
3300019202|Ga0179947_1129592 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 792 | Open in IMG/M |
3300019207|Ga0180034_1024333 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300019212|Ga0180106_1039333 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
3300019222|Ga0179957_1122075 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 790 | Open in IMG/M |
3300019240|Ga0181510_1011194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 809 | Open in IMG/M |
3300019244|Ga0180111_1057911 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 516 | Open in IMG/M |
3300019245|Ga0187791_1148272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 750 | Open in IMG/M |
3300019245|Ga0187791_1423134 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 710 | Open in IMG/M |
3300019250|Ga0187790_1011510 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
3300019265|Ga0187792_1075397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 716 | Open in IMG/M |
3300019279|Ga0184642_1371599 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 792 | Open in IMG/M |
3300020076|Ga0206355_1505059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 775 | Open in IMG/M |
3300020081|Ga0206354_10064934 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 795 | Open in IMG/M |
3300020610|Ga0154015_1354900 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300021273|Ga0210340_1001444 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
3300021282|Ga0210303_1089103 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
3300021283|Ga0210357_1063716 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 705 | Open in IMG/M |
3300021307|Ga0179585_1053491 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 780 | Open in IMG/M |
3300021336|Ga0210307_1394540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
3300021859|Ga0210334_10213364 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 738 | Open in IMG/M |
3300021861|Ga0213853_10447056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
3300021909|Ga0213846_1048670 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 670 | Open in IMG/M |
3300021909|Ga0213846_1066248 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300021951|Ga0222624_1304571 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
3300021967|Ga0213848_1015798 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 513 | Open in IMG/M |
3300022154|Ga0213929_1011517 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
3300022166|Ga0213932_1046789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 633 | Open in IMG/M |
3300022195|Ga0222625_1440399 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 793 | Open in IMG/M |
3300022195|Ga0222625_1633124 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
3300022372|Ga0210293_114247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
3300022498|Ga0242644_1012192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 786 | Open in IMG/M |
3300022499|Ga0242641_1004254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1084 | Open in IMG/M |
3300022499|Ga0242641_1038912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 546 | Open in IMG/M |
3300022501|Ga0242645_1008110 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
3300022501|Ga0242645_1008192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
3300022507|Ga0222729_1018721 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
3300022510|Ga0242652_1013095 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
3300022511|Ga0242651_1021547 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 679 | Open in IMG/M |
3300022523|Ga0242663_1015751 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1082 | Open in IMG/M |
3300022525|Ga0242656_1100135 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 567 | Open in IMG/M |
3300022529|Ga0242668_1037375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300022531|Ga0242660_1071281 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300022708|Ga0242670_1018774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300022711|Ga0242674_1022145 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 750 | Open in IMG/M |
3300022714|Ga0242671_1030366 | Not Available | 813 | Open in IMG/M |
3300022726|Ga0242654_10137583 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
3300023553|Ga0247524_115258 | Not Available | 519 | Open in IMG/M |
3300023691|Ga0228704_107471 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 844 | Open in IMG/M |
3300024480|Ga0255223_1032332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 876 | Open in IMG/M |
3300024484|Ga0256332_1129146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 541 | Open in IMG/M |
3300024487|Ga0255222_1040460 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 697 | Open in IMG/M |
3300024547|Ga0255292_1055256 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 780 | Open in IMG/M |
3300024557|Ga0255283_1064211 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 798 | Open in IMG/M |
3300024566|Ga0256309_1116049 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 668 | Open in IMG/M |
3300024849|Ga0255230_1041196 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 835 | Open in IMG/M |
3300024865|Ga0256340_1120778 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 634 | Open in IMG/M |
3300024957|Ga0208121_117899 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 857 | Open in IMG/M |
3300025679|Ga0207933_1191145 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 574 | Open in IMG/M |
3300025763|Ga0255250_1132901 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 535 | Open in IMG/M |
3300026435|Ga0256297_1031686 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
3300026567|Ga0256303_1082892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 682 | Open in IMG/M |
3300026568|Ga0255240_1056525 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 891 | Open in IMG/M |
3300028619|Ga0257136_1045338 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 794 | Open in IMG/M |
3300028647|Ga0272412_1206191 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300028650|Ga0302170_10184046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 533 | Open in IMG/M |
3300029687|Ga0265602_1032731 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 697 | Open in IMG/M |
3300029697|Ga0256301_1050397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 712 | Open in IMG/M |
3300029699|Ga0255233_1078900 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 652 | Open in IMG/M |
3300029923|Ga0311347_10540521 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 708 | Open in IMG/M |
3300030114|Ga0311333_11736490 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 541 | Open in IMG/M |
3300030594|Ga0210280_1024848 | Not Available | 863 | Open in IMG/M |
3300030630|Ga0210282_10216277 | Not Available | 630 | Open in IMG/M |
3300030631|Ga0210279_10113300 | Not Available | 845 | Open in IMG/M |
3300030777|Ga0075402_10087952 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 686 | Open in IMG/M |
3300030812|Ga0265734_105686 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 546 | Open in IMG/M |
3300030816|Ga0265729_101995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 674 | Open in IMG/M |
3300030836|Ga0265767_102584 | Not Available | 981 | Open in IMG/M |
3300030845|Ga0075397_10048594 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 684 | Open in IMG/M |
3300030888|Ga0265769_105041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 793 | Open in IMG/M |
3300030903|Ga0308206_1070115 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 736 | Open in IMG/M |
3300030904|Ga0308198_1035909 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 726 | Open in IMG/M |
3300030917|Ga0075382_10050917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 521 | Open in IMG/M |
3300030941|Ga0265737_103826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
3300030970|Ga0075381_11557219 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 541 | Open in IMG/M |
3300030971|Ga0075375_10105665 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 710 | Open in IMG/M |
3300030988|Ga0308183_1053186 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
3300031240|Ga0265320_10193648 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 908 | Open in IMG/M |
3300031493|Ga0314826_114744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 787 | Open in IMG/M |
3300031503|Ga0314820_104994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 792 | Open in IMG/M |
3300031663|Ga0307484_104654 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 817 | Open in IMG/M |
3300033527|Ga0316586_1044131 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 789 | Open in IMG/M |
3300033529|Ga0316587_1042969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
3300034194|Ga0370499_0074024 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 829 | Open in IMG/M |
3300034659|Ga0314780_069796 | Not Available | 746 | Open in IMG/M |
3300034667|Ga0314792_069138 | Not Available | 820 | Open in IMG/M |
3300034671|Ga0314796_048870 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300034672|Ga0314797_045835 | Not Available | 781 | Open in IMG/M |
3300034673|Ga0314798_159035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 521 | Open in IMG/M |
3300034675|Ga0314800_074870 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 520 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 15.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.55% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.48% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 7.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.67% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.06% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.64% |
Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 3.03% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.42% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.42% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.42% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.82% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.82% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.21% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.21% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.21% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.21% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.21% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.21% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.21% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.61% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.61% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.61% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.61% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.61% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.61% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.61% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.61% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.61% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.61% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300008884 | Microbial communities of wastewater sludge from Singapore - Sludge3_b2_February | Environmental | Open in IMG/M |
3300009196 | Microbial communities of wastewater sludge from Singapore - Sludge1_b2_February | Environmental | Open in IMG/M |
3300009199 | Microbial communities of wastewater sludge from Singapore - Sludge7_b2_February | Environmental | Open in IMG/M |
3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
3300009249 | Microbial communities of water from Amazon river, Brazil - RCM15 | Environmental | Open in IMG/M |
3300009252 | Microbial communities of water from Amazon river, Brazil - RCM16 | Environmental | Open in IMG/M |
3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
3300009261 | Microbial communities of water from Amazon river, Brazil - RCM23 | Environmental | Open in IMG/M |
3300009281 | Microbial communities of wastewater sludge from Singapore - Sludge_b1_October | Environmental | Open in IMG/M |
3300009295 | Microbial communities of wastewater sludge from Singapore - Sludge5_b2_February | Environmental | Open in IMG/M |
3300009382 | Microbial communities of water from Amazon river, Brazil - RCM19 | Environmental | Open in IMG/M |
3300010066 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010071 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010092 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010115 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010144 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011045 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011054 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012756 | Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300015250 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293B_16_10D | Environmental | Open in IMG/M |
3300019165 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019178 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019200 | Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019202 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA5_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019207 | Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019222 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021273 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021283 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.587 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021336 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021909 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - NH:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021967 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022154 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022166 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022372 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023553 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023691 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024547 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024849 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024957 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 62_LOW9 (SPAdes) | Environmental | Open in IMG/M |
3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025763 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
3300028619 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028650 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_1 | Environmental | Open in IMG/M |
3300029687 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030594 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030630 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030631 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030777 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030812 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030816 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030845 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030941 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030970 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030971 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
3300031493 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031503 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031663 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034675 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0103746_100189142 | 3300008884 | Wastewater Sludge | MRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTSDFGPG |
Ga0103745_100250972 | 3300009196 | Wastewater Sludge | MRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTSELGI |
Ga0103748_100350592 | 3300009199 | Wastewater Sludge | MRPTAAHAAWSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPG |
Ga0103851_10423901 | 3300009225 | River Water | MRPTASHAAMSSVGKHTARESEAPNAVRMGKSAWRAP |
Ga0103856_100418631 | 3300009233 | River Water | MRPTASHAAMSSVGKHPARESEAPNAMRMEKSAWRAPTSDKKK |
Ga0103857_100489651 | 3300009235 | River Water | MRPTASHAAMSSVGKHPARESEAPNAMRMEKSAWRAPTSDF |
Ga0103857_100500031 | 3300009235 | River Water | MRPRPSHAAVSSVGEHTARESEAPNVVRMGKSAWRAPTPDFGPGAARFP |
Ga0103858_101084331 | 3300009239 | River Water | MRPRPSHAAVSSVGEHTARESEAPNDVRMGKSAWRAPTPDFGPGAARFP |
Ga0103860_100577311 | 3300009243 | River Water | MRPTASLAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDKK |
Ga0103860_100614202 | 3300009243 | River Water | MRPRASLAAKSSVGKHTARESEAPNVVRMGKSAWRAPT |
Ga0103862_10213421 | 3300009249 | River Water | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGPGSARS |
Ga0103862_10226791 | 3300009249 | River Water | MRPRPSHAAVSSVGEHTARESEAPNAVPMGKSAWRAPTPDFGPGAARFP |
Ga0103863_100220811 | 3300009252 | River Water | MRPTASLAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDK |
Ga0103869_100837421 | 3300009257 | River Water | MRPRASHAAVSSVGKHTARESEAPNVVRMGKSAWR |
Ga0103870_10173611 | 3300009261 | River Water | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGPGSARSPG |
Ga0103744_100726962 | 3300009281 | Wastewater Sludge | MRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTPDF |
Ga0103747_100772642 | 3300009295 | Wastewater Sludge | MRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTSDKPGAQRKR |
Ga0103866_10124931 | 3300009382 | River Water | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDKKK |
Ga0127427_1059742 | 3300010066 | Grasslands Soil | MRPIASHAAMSSVGKHTARESEAPNVVRMGKSAWRA |
Ga0127477_1098142 | 3300010071 | Grasslands Soil | MRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRA |
Ga0127477_1260161 | 3300010071 | Grasslands Soil | MRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWRAPTP |
Ga0127492_10894051 | 3300010087 | Grasslands Soil | MRPTPSHAAVSSVGKHTARESEAPNVVRMGKSAWRA |
Ga0127468_10022732 | 3300010092 | Grasslands Soil | MRPIASHAAMSSVGKHTARESEAPNVVRMGKSAWR |
Ga0127500_10352531 | 3300010103 | Grasslands Soil | MRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWRAP |
Ga0127458_11237632 | 3300010112 | Grasslands Soil | MRPTPSHAAVSSVGKHTARESEAPNAVRMEKSAWR |
Ga0127495_11021111 | 3300010115 | Grasslands Soil | MRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWR |
Ga0127449_10147032 | 3300010117 | Grasslands Soil | MRPTAAHAALSSVGKHPARESEAPNVMRMGKSAWR |
Ga0127449_10799422 | 3300010117 | Grasslands Soil | MRPIASHAAMSSVGKHTARESEAPNVVRMVKSAWRAPT |
Ga0127465_10825632 | 3300010118 | Grasslands Soil | MRPTAAHAALSSVGKHPARESEAPNAMRMEKSAWRA |
Ga0127452_10695991 | 3300010119 | Grasslands Soil | MRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWRAPT |
Ga0127455_10934671 | 3300010132 | Grasslands Soil | MRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAP |
Ga0127499_10764871 | 3300010141 | Grasslands Soil | MRPTPSHAAVSSVGKHTARESEAPNVVRMEKSAWR |
Ga0115593_10113582 | 3300010144 | Wetland | MRPRAAHAAQSSVGEHTARESEAPNVVRLGKSAWRAP |
Ga0126319_15944531 | 3300010147 | Soil | MRPITSHAAVSGVGKHTARESEAPNVVRMGKSAWRAPTPAMRPR |
Ga0134125_115767981 | 3300010371 | Terrestrial Soil | MRSITSHAAMSGVGKHTARESEAPNVVRMGKSAWRAPTPDFGPG |
Ga0134127_133277261 | 3300010399 | Terrestrial Soil | MRPTASHAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPEFGPDPARGPG |
Ga0126351_11144511 | 3300010860 | Boreal Forest Soil | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGP |
Ga0126359_16558411 | 3300010869 | Boreal Forest Soil | MRPRAAHAALSGVGEHTARESERAQCVPMGKSAWRAPTPKF |
Ga0126350_107827682 | 3300010880 | Boreal Forest Soil | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGPGSARSPGLY |
Ga0138598_1067871 | 3300011045 | Peatlands Soil | MRPTAAHAALSSVGKHPARESEAPNAMRMEKSAWRAPTS |
Ga0138523_10492551 | 3300011054 | Peatlands Soil | MRPIASHAAMSSVGKHTARESEAPNVVRMGKSAWRAPT |
Ga0126317_106500201 | 3300011332 | Soil | MRPRASLAARSSVGKHTARESEAPNVVRMGKSAWRAPTPAAM |
Ga0151652_111902522 | 3300011340 | Wetland | MRPRASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPTP |
Ga0137443_11231421 | 3300011433 | Soil | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAP |
Ga0134034_11734591 | 3300012375 | Grasslands Soil | MRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPEFGPE |
Ga0134029_11065671 | 3300012377 | Grasslands Soil | MRPKSAHAALSGVGEHTARESERAQCVPMGKSAWRAPTPKFD |
Ga0134058_11628691 | 3300012379 | Grasslands Soil | MRPIASLAAMSGVGKHTARESEAPNDVRMGKSAWRAPTPTPSAD |
Ga0134026_10640621 | 3300012381 | Grasslands Soil | MRPTSAHAALSSVGKHPARESEAPNAMRMEKSAWRAPTSDFGP |
Ga0134046_11538991 | 3300012386 | Grasslands Soil | MRPKASHAAVSGVGKHTARESEAPNAVRMGKSAWRAPT |
Ga0134031_11879271 | 3300012388 | Grasslands Soil | MRPTSAHAALSSVGKHPARESEAPNAMRMEKSAWRA |
Ga0134040_12570082 | 3300012389 | Grasslands Soil | MRPTASHAAVSSVGKHTARESEAPNVVRMEKSAWRAPTSDF |
Ga0134057_12255861 | 3300012396 | Grasslands Soil | MRPIAPLAAVSGVGKHTARESEAPNDVRMGKSAWRAP |
Ga0134056_11858131 | 3300012397 | Grasslands Soil | MRPIASHAAMSGVGKHTARESEAPNVVRMGKTAWRAPT |
Ga0134055_10925221 | 3300012401 | Grasslands Soil | MRPIASLAAMSGVGKHTARESEAPNDVRMGKTAWRAP |
Ga0134060_11753882 | 3300012410 | Grasslands Soil | MRPIAPLAAVSGVGKHTARESEAPNDVRMGKSAWRAPT |
Ga0150984_1009836182 | 3300012469 | Avena Fatua Rhizosphere | MRPRASLAAKSSVGKHTARESEAPNAVRMGKSAWRAPTP |
Ga0137398_107973132 | 3300012683 | Vadose Zone Soil | MRPRASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPTPDFGPGIARCP |
Ga0138272_11867332 | 3300012756 | Freshwater Lake | MRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWR |
Ga0170791_126024872 | 3300013295 | Freshwater | MRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPTP |
Ga0180072_10950351 | 3300015250 | Soil | MRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGTARCPGL |
Ga0184589_1138341 | 3300019165 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEF |
Ga0184583_1017672 | 3300019178 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFG |
Ga0180036_10331861 | 3300019200 | Estuarine | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTP |
Ga0180032_10439942 | 3300019201 | Estuarine | MRPKAALAAQSGVGEHTARESEAPNVVRLGKSAWRAPTP |
Ga0180032_11296871 | 3300019201 | Estuarine | MRPRPSHAAVSSVGEHTARESEAPNDVPMGKSAWRAPTP |
Ga0179947_11295922 | 3300019202 | Anaerobic Digestor Sludge | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRA |
Ga0180034_10243331 | 3300019207 | Estuarine | MRPKAALAAQSGVGEHTARESEAPNVVRLGKSAWRAP |
Ga0180106_10393332 | 3300019212 | Groundwater Sediment | MRPKASHAAKSSVGKHTARESEAPNVVRMGKSAWRAP |
Ga0179957_11220751 | 3300019222 | Anaerobic Digestor Sludge | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWR |
Ga0181510_10111942 | 3300019240 | Peatland | MRSRTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTP |
Ga0180111_10579112 | 3300019244 | Groundwater Sediment | MRPKASHAAVSSVGKHTARESEAPNVVRMGKSAWR |
Ga0187791_11482722 | 3300019245 | Peatland | MRPKASHAAVSGVGKHTARESEAPNAVRMGKSAWRAPTP |
Ga0187791_14231341 | 3300019245 | Peatland | MRSRASLAAESGVGEHTARESESAQCVRLGKSAWRAPT |
Ga0187790_10115101 | 3300019250 | Peatland | MRSRASLAAESGVGEHTARESESAQCVRLGKSAWRAPTP |
Ga0187792_10753971 | 3300019265 | Peatland | MRPTASHAAVSGVGKHTARESEAPNAVRMGKSAWRA |
Ga0184642_13715991 | 3300019279 | Groundwater Sediment | MRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRA |
Ga0206355_15050592 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIASHAAMSSVGKHTARESEAPNVVRKGKSAWRA |
Ga0206354_100649341 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIASHAAMSSVGKHTARESEAPNVVRKGKSAWR |
Ga0154015_13549001 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPIASHAAMSSVGKHTARESEAPNVVRKGKSAWRAPT |
Ga0210340_10014441 | 3300021273 | Estuarine | MRPRPSHAAVSSVGEHTARESEAPNDVPMGKSAWRA |
Ga0210303_10891031 | 3300021282 | Estuarine | MRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWRAPTP |
Ga0210357_10637161 | 3300021283 | Estuarine | MRPTASHAAVSSVGKHTARESEAPNVVRKGKSAWRAPTP |
Ga0179585_10534912 | 3300021307 | Vadose Zone Soil | MRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAP |
Ga0210307_13945401 | 3300021336 | Estuarine | MRPIASHAAVSSVGKHTARESEAPNVVRMGKSAWRA |
Ga0210334_102133641 | 3300021859 | Estuarine | MRPTASHAAVSSVGKHTARESEAPNVVRKGKSAWRAPTPDFGPGAARLPG |
Ga0213853_104470561 | 3300021861 | Watersheds | MRPTASHAAVSSVGKHTARESEAPNAVRMGKSTWRVPT |
Ga0213846_10486701 | 3300021909 | Watersheds | MRPIAPLAAVSGVGKHTARESEAPNDVRMGKSAWRAPTP |
Ga0213846_10662482 | 3300021909 | Watersheds | MRPTAAHAALSSVGKHPARESEAPNAMRMEKSAWRAPTSD |
Ga0222624_13045711 | 3300021951 | Groundwater Sediment | MRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTP |
Ga0213848_10157982 | 3300021967 | Watersheds | MRPRASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTP |
Ga0213929_10115172 | 3300022154 | Freshwater | MRPTASHAAVSSVGEHTARESESAQCVRLGKCATG |
Ga0213932_10467891 | 3300022166 | Freshwater | MRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTP |
Ga0222625_14403991 | 3300022195 | Groundwater Sediment | MRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWR |
Ga0222625_16331241 | 3300022195 | Groundwater Sediment | MRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPT |
Ga0210293_1142471 | 3300022372 | Estuarine | MRPTASHAAVSSVGKHTARESEAPNVVRKGKSAWRAPTPD |
Ga0242644_10121922 | 3300022498 | Soil | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAP |
Ga0242641_10042542 | 3300022499 | Soil | MRPIASHAAMSSVGKHTARESEAPNAVRMGKSAWRAP |
Ga0242641_10389122 | 3300022499 | Soil | MRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWRAP |
Ga0242645_10081101 | 3300022501 | Soil | MRSTASLAAVSGVGKHTARESEAPNAVRMGKSAWRAP |
Ga0242645_10081922 | 3300022501 | Soil | MRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWRA |
Ga0222729_10187212 | 3300022507 | Soil | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPT |
Ga0242652_10130951 | 3300022510 | Soil | MRPIPSHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSEGRD |
Ga0242651_10215472 | 3300022511 | Soil | MRPRASLAAMSSVGKHTARESEAPNVVRLGKSAWR |
Ga0242663_10157511 | 3300022523 | Soil | MRPRASLAAKSSVGKHTARESEAPNVVRMGKSAWRA |
Ga0242656_11001351 | 3300022525 | Soil | MRPIASHAAMSSVGKHTARESEAPNAVRMGKSAWRA |
Ga0242668_10373752 | 3300022529 | Soil | MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTS |
Ga0242660_10712813 | 3300022531 | Soil | MRPIASHAAMSGVGKHTARESEAPNVVRMGKSAWRAPT |
Ga0242670_10187741 | 3300022708 | Soil | MRPTSSHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTP |
Ga0242674_10221451 | 3300022711 | Soil | MRSTASLAAVSGVGKHTARESEAPNVVRMGKSAWRAPTPSN |
Ga0242671_10303661 | 3300022714 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFGP |
Ga0242654_101375831 | 3300022726 | Soil | MRPRASLAAKSSVGKHTARESEAPNVVRMGKSAWRAPTP |
Ga0247524_1152581 | 3300023553 | Soil | MRPTTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTP |
Ga0228704_1074712 | 3300023691 | Freshwater | MRPKASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDFGPGSARSPGLNL |
Ga0255223_10323321 | 3300024480 | Freshwater | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDF |
Ga0256332_11291461 | 3300024484 | Freshwater | MRPTAAHAAWSSVGEHTARESEAPNVVRMGKSAWR |
Ga0255222_10404601 | 3300024487 | Freshwater | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGP |
Ga0255292_10552561 | 3300024547 | Freshwater | MRPRSSHAAVSSVGEHTARESEAPNVVRMGKSAWRAPTP |
Ga0255283_10642111 | 3300024557 | Freshwater | MRPRSSHAAVSGVGEHTARESEAPNVVRMGKSAWRAP |
Ga0256309_11160491 | 3300024566 | Freshwater | MRPRPSHAAVSSVGEHTARESEAPNDVPMGKSAWRAPT |
Ga0255230_10411961 | 3300024849 | Freshwater | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPG |
Ga0256340_11207781 | 3300024865 | Freshwater | MRPRSSHAAVSGVGEHTARESEAPNVVRMGKSAWRA |
Ga0208121_1178991 | 3300024957 | Freshwater Sediment | MRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPTSDFGPGSARSP |
Ga0207933_11911451 | 3300025679 | Arctic Peat Soil | MRPIASHAAVSSVGKHTARESEAPNVVRKGKSVWRAPTPDFGPG |
Ga0255250_11329011 | 3300025763 | Freshwater | MRPTASHAAMSSVGKHTARESEAPNAVRMEKSAWR |
Ga0256297_10316861 | 3300026435 | Freshwater | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPV |
Ga0256303_10828921 | 3300026567 | Freshwater | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPT |
Ga0255240_10565251 | 3300026568 | Freshwater | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGT |
Ga0208960_10623991 | 3300027649 | Freshwater Lentic | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGTARCPGLY |
Ga0257136_10453381 | 3300028619 | Marine | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWR |
Ga0272412_12061911 | 3300028647 | Activated Sludge | MRPTAAHAAWSSVGKHTARESEAPNAVRMGKSAWRAPTPD |
Ga0302170_101840461 | 3300028650 | Fen | MRPTASHAAMSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPG |
Ga0265602_10327312 | 3300029687 | Marine | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFG |
Ga0256301_10503971 | 3300029697 | Freshwater | MRPIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGTEVE |
Ga0255233_10789003 | 3300029699 | Freshwater | MRPRPSHAAVSSVGEHTARESEAPNDVPMGKSAWR |
Ga0311347_105405212 | 3300029923 | Fen | MRSIASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDLGPGTARCPGFYLSR |
Ga0311333_117364901 | 3300030114 | Fen | MRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFGPGT |
Ga0210280_10248481 | 3300030594 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFEREKEK |
Ga0210282_102162771 | 3300030630 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEKKRNEK |
Ga0210279_101133001 | 3300030631 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFGPGTARF |
Ga0075402_100879521 | 3300030777 | Soil | MRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPE |
Ga0265734_1056862 | 3300030812 | Soil | MRPIASHAAMSSVGKHTARESEAPNVVRMGKSAWRAP |
Ga0265729_1019951 | 3300030816 | Soil | MRPIASHAAVSSVGKHTARESEAPNVVRKGKSAWRAP |
Ga0265767_1025842 | 3300030836 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFGPGTA |
Ga0075397_100485941 | 3300030845 | Soil | MRPTASHAAVSSVGKHPARESEAPNVVRMEKSAWRAPT |
Ga0265769_1050411 | 3300030888 | Soil | MRSIASLAAVSGVGKHTARESEAPNVVRMGKSAWRAP |
Ga0308206_10701151 | 3300030903 | Soil | MRPTASHAAMSSVGKHTARESEAPNAVRMGKSAWRA |
Ga0308198_10359092 | 3300030904 | Soil | MRPTASHAAMSSVGKHPARESEAPNAMRMEKSAWR |
Ga0075382_100509171 | 3300030917 | Soil | MRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPK |
Ga0265737_1038261 | 3300030941 | Soil | MRPIASHAAVSSVGKHTARESEAPNVVRKGKSAWRAPTP |
Ga0075381_115572191 | 3300030970 | Soil | MRPTASHAAVSSVGKHPARESEAPNVVRMEKSAWRAPTS |
Ga0075375_101056651 | 3300030971 | Soil | MRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPEKEQ |
Ga0308183_10531862 | 3300030988 | Soil | MRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPEFGPNL |
Ga0265320_101936481 | 3300031240 | Rhizosphere | MRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDFG |
Ga0314826_1147441 | 3300031493 | Soil | MRPIASHAAVSSVGKHTARESEAPNVVRMGKSAWR |
Ga0314820_1049941 | 3300031503 | Soil | MRPTASHAAMSSVGKHTARESEAPNSVPLGKSAWR |
Ga0307484_1046542 | 3300031663 | Hardwood Forest Soil | MRPRASLAAMSSVGKHTARESEAPNVVRMGKSAWRAPTPGRRGL |
Ga0316586_10441312 | 3300033527 | Rhizosphere | MRPRASLAAVSSVGKHTARESEAPNAVRMGKSAWR |
Ga0316587_10429691 | 3300033529 | Rhizosphere | MRPRAPLAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDAEKP |
Ga0370499_0074024_3_137 | 3300034194 | Untreated Peat Soil | MRPTASHAAVSSVGKHTARESEAPNVVRMGKSAWRAPTPDFGPGT |
Ga0314780_069796_634_744 | 3300034659 | Soil | MRPKHPHAAESGVGEHTARESEAPNVVRLGKSAWRAP |
Ga0314792_069138_703_819 | 3300034667 | Soil | MRPKHPHAAESGVGEHTARESEAPNVVPLGKSAWRAPTP |
Ga0314796_048870_687_800 | 3300034671 | Soil | MRPTASHAAVSSVGKHPARESEAPNAMRMEKSAWRAPT |
Ga0314797_045835_1_114 | 3300034672 | Soil | MRPKHPHAAESGVGEHTARESEAPNVVRLGKSAWRAPT |
Ga0314798_159035_2_118 | 3300034673 | Soil | MRPIAAHAALSSVGKHPARESEAPNAMRMGKSAWRAPTP |
Ga0314800_074870_389_520 | 3300034675 | Soil | MRPTASHAAVSSVGKHTARESEAPNAVRMGKSAWRAPTPDRRAN |
⦗Top⦘ |