| Basic Information | |
|---|---|
| Family ID | F037639 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 40 residues |
| Representative Sequence | YQGIDTSFLVATLTAAIQEQQALITQLTARITALEGA |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 92.81 % |
| % of genes from short scaffolds (< 2000 bps) | 88.02 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (47.305 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.946 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.677 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.874 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 5.39 |
| PF07460 | NUMOD3 | 1.80 |
| PF13884 | Peptidase_S74 | 1.80 |
| PF01541 | GIY-YIG | 0.60 |
| PF11649 | T4_neck-protein | 0.60 |
| PF00959 | Phage_lysozyme | 0.60 |
| PF01391 | Collagen | 0.60 |
| PF00182 | Glyco_hydro_19 | 0.60 |
| PF05065 | Phage_capsid | 0.60 |
| PF16080 | Phage_holin_2_3 | 0.60 |
| PF10746 | Phage_holin_2_2 | 0.60 |
| PF09374 | PG_binding_3 | 0.60 |
| PF00386 | C1q | 0.60 |
| PF09636 | XkdW | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.60 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.60 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.28 % |
| Unclassified | root | N/A | 37.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000517|PR_CR_10_Liq_3_inCRDRAFT_1047147 | Not Available | 593 | Open in IMG/M |
| 3300001605|Draft_10208808 | Not Available | 1169 | Open in IMG/M |
| 3300001605|Draft_10390145 | Not Available | 740 | Open in IMG/M |
| 3300001842|RCM30_1107051 | Not Available | 528 | Open in IMG/M |
| 3300002138|M3t6FKB1_1396566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 38629 | Open in IMG/M |
| 3300002408|B570J29032_109612691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300002930|Water_104205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2270 | Open in IMG/M |
| 3300003393|JGI25909J50240_1121425 | Not Available | 515 | Open in IMG/M |
| 3300004095|Ga0007829_10053223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300004128|Ga0066180_10172107 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300004774|Ga0007794_10066821 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300004802|Ga0007801_10158650 | Not Available | 644 | Open in IMG/M |
| 3300005580|Ga0049083_10072959 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300005585|Ga0049084_10256730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300006109|Ga0007870_1118450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Lactococcus → Lactococcus raffinolactis | 517 | Open in IMG/M |
| 3300006115|Ga0007816_1017880 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300006122|Ga0007837_1063184 | Not Available | 627 | Open in IMG/M |
| 3300006802|Ga0070749_10026399 | All Organisms → Viruses → Predicted Viral | 3648 | Open in IMG/M |
| 3300006805|Ga0075464_10766878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 598 | Open in IMG/M |
| 3300006863|Ga0075459_1096812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300006875|Ga0075473_10324387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300006947|Ga0075444_10412360 | Not Available | 506 | Open in IMG/M |
| 3300007538|Ga0099851_1308972 | Not Available | 557 | Open in IMG/M |
| 3300007597|Ga0102919_1061124 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1178 | Open in IMG/M |
| 3300007640|Ga0070751_1220614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300007974|Ga0105747_1214213 | Not Available | 638 | Open in IMG/M |
| 3300007992|Ga0105748_10339041 | Not Available | 642 | Open in IMG/M |
| 3300008259|Ga0114841_1269055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300008267|Ga0114364_1048951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
| 3300008267|Ga0114364_1104123 | Not Available | 877 | Open in IMG/M |
| 3300008448|Ga0114876_1024486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3058 | Open in IMG/M |
| 3300008448|Ga0114876_1050954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1869 | Open in IMG/M |
| 3300008450|Ga0114880_1011484 | All Organisms → Viruses → Predicted Viral | 4350 | Open in IMG/M |
| 3300009068|Ga0114973_10444370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300009081|Ga0105098_10769191 | Not Available | 517 | Open in IMG/M |
| 3300009151|Ga0114962_10349913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300009151|Ga0114962_10482396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300009155|Ga0114968_10004132 | Not Available | 10822 | Open in IMG/M |
| 3300009159|Ga0114978_10535687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300009160|Ga0114981_10742858 | Not Available | 518 | Open in IMG/M |
| 3300009161|Ga0114966_10241025 | Not Available | 1122 | Open in IMG/M |
| 3300009161|Ga0114966_10512263 | Not Available | 682 | Open in IMG/M |
| 3300009164|Ga0114975_10607432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300009170|Ga0105096_10460754 | Not Available | 659 | Open in IMG/M |
| 3300009180|Ga0114979_10441750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300009684|Ga0114958_10265616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300010160|Ga0114967_10477894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300010354|Ga0129333_10140118 | Not Available | 2222 | Open in IMG/M |
| 3300010374|Ga0114986_1051397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300010885|Ga0133913_12734511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
| 3300012012|Ga0153799_1085979 | Not Available | 563 | Open in IMG/M |
| 3300013005|Ga0164292_10981706 | Not Available | 528 | Open in IMG/M |
| 3300013086|Ga0163202_1155572 | Not Available | 505 | Open in IMG/M |
| 3300013372|Ga0177922_11103500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300014811|Ga0119960_1043587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300015050|Ga0181338_1040062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300017716|Ga0181350_1129958 | Not Available | 599 | Open in IMG/M |
| 3300017722|Ga0181347_1118918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 740 | Open in IMG/M |
| 3300017722|Ga0181347_1150195 | Not Available | 636 | Open in IMG/M |
| 3300017723|Ga0181362_1020476 | Not Available | 1422 | Open in IMG/M |
| 3300017723|Ga0181362_1054882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300017736|Ga0181365_1126665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300017754|Ga0181344_1133605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 711 | Open in IMG/M |
| 3300017754|Ga0181344_1141362 | Not Available | 688 | Open in IMG/M |
| 3300017761|Ga0181356_1247331 | Not Available | 509 | Open in IMG/M |
| 3300017761|Ga0181356_1249263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300017774|Ga0181358_1109535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
| 3300017774|Ga0181358_1228123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300017774|Ga0181358_1271808 | Not Available | 526 | Open in IMG/M |
| 3300017777|Ga0181357_1146934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| 3300017777|Ga0181357_1276818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300017777|Ga0181357_1303765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300017777|Ga0181357_1332311 | Not Available | 509 | Open in IMG/M |
| 3300017778|Ga0181349_1204138 | Not Available | 681 | Open in IMG/M |
| 3300017778|Ga0181349_1209708 | All Organisms → Viruses | 669 | Open in IMG/M |
| 3300017780|Ga0181346_1022799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2625 | Open in IMG/M |
| 3300017780|Ga0181346_1243097 | Not Available | 632 | Open in IMG/M |
| 3300017780|Ga0181346_1333129 | Not Available | 507 | Open in IMG/M |
| 3300017784|Ga0181348_1177594 | Not Available | 778 | Open in IMG/M |
| 3300017784|Ga0181348_1220697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300017784|Ga0181348_1231329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300017784|Ga0181348_1242031 | Not Available | 628 | Open in IMG/M |
| 3300017784|Ga0181348_1272177 | Not Available | 577 | Open in IMG/M |
| 3300017785|Ga0181355_1167970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300017785|Ga0181355_1353844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300019784|Ga0181359_1098711 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300020714|Ga0214182_1032392 | Not Available | 720 | Open in IMG/M |
| 3300021137|Ga0214165_1096747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 569 | Open in IMG/M |
| 3300021961|Ga0222714_10060418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-1 | 2567 | Open in IMG/M |
| 3300021963|Ga0222712_10405898 | Not Available | 827 | Open in IMG/M |
| 3300021963|Ga0222712_10420086 | Not Available | 808 | Open in IMG/M |
| 3300022179|Ga0181353_1071653 | Not Available | 884 | Open in IMG/M |
| 3300022190|Ga0181354_1205611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300022198|Ga0196905_1153740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300022407|Ga0181351_1246234 | Not Available | 560 | Open in IMG/M |
| 3300022407|Ga0181351_1253783 | Not Available | 545 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10137852 | Not Available | 1040 | Open in IMG/M |
| 3300024343|Ga0244777_10378653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300024555|Ga0255280_1125689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300025369|Ga0208382_1029795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300025417|Ga0208616_1045324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300025423|Ga0208746_1024342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
| 3300025635|Ga0208147_1074683 | Not Available | 842 | Open in IMG/M |
| 3300025636|Ga0209136_1163265 | All Organisms → Viruses | 574 | Open in IMG/M |
| 3300025732|Ga0208784_1200292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter junii | 582 | Open in IMG/M |
| 3300025744|Ga0255245_1016776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300025896|Ga0208916_10217278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300026572|Ga0255270_1056197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
| 3300027193|Ga0208800_1055379 | Not Available | 539 | Open in IMG/M |
| 3300027601|Ga0255079_1106320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300027621|Ga0208951_1096164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300027649|Ga0208960_1073058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300027733|Ga0209297_1021799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3039 | Open in IMG/M |
| 3300027733|Ga0209297_1250540 | Not Available | 679 | Open in IMG/M |
| 3300027749|Ga0209084_1369910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300027785|Ga0209246_10161092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300027798|Ga0209353_10121756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300027798|Ga0209353_10344370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300027798|Ga0209353_10347046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300027798|Ga0209353_10390730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300028025|Ga0247723_1044137 | All Organisms → Viruses → Predicted Viral | 1308 | Open in IMG/M |
| 3300028108|Ga0256305_1101860 | Not Available | 693 | Open in IMG/M |
| 3300028392|Ga0304729_1051552 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300028393|Ga0304728_1186060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300028393|Ga0304728_1273061 | Not Available | 557 | Open in IMG/M |
| 3300028394|Ga0304730_1252152 | Not Available | 635 | Open in IMG/M |
| 3300031673|Ga0307377_10551517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300031707|Ga0315291_11100690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 659 | Open in IMG/M |
| 3300031746|Ga0315293_11168097 | Not Available | 537 | Open in IMG/M |
| 3300031758|Ga0315907_10065627 | All Organisms → Viruses → Predicted Viral | 3156 | Open in IMG/M |
| 3300031857|Ga0315909_10435025 | Not Available | 928 | Open in IMG/M |
| 3300031885|Ga0315285_10283957 | All Organisms → Viruses → Predicted Viral | 1253 | Open in IMG/M |
| 3300031951|Ga0315904_10436986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
| 3300031951|Ga0315904_11454982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300031952|Ga0315294_10598989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
| 3300031952|Ga0315294_10718028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300031952|Ga0315294_11621393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300032117|Ga0316218_1144385 | Not Available | 892 | Open in IMG/M |
| 3300032156|Ga0315295_10668278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
| 3300032156|Ga0315295_11488809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300032173|Ga0315268_12680775 | Not Available | 512 | Open in IMG/M |
| 3300032275|Ga0315270_10250375 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300032401|Ga0315275_12444553 | Not Available | 542 | Open in IMG/M |
| 3300032401|Ga0315275_12568806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300032516|Ga0315273_11658273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300033557|Ga0316617_102777835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300033996|Ga0334979_0607902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300034018|Ga0334985_0231756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
| 3300034068|Ga0334990_0558453 | Not Available | 605 | Open in IMG/M |
| 3300034092|Ga0335010_0312454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300034101|Ga0335027_0574321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300034104|Ga0335031_0481808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300034112|Ga0335066_0336513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 842 | Open in IMG/M |
| 3300034117|Ga0335033_0426679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300034118|Ga0335053_0066576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2539 | Open in IMG/M |
| 3300034119|Ga0335054_0441762 | Not Available | 737 | Open in IMG/M |
| 3300034119|Ga0335054_0530398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300034121|Ga0335058_0238189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
| 3300034283|Ga0335007_0228221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.95% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.98% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 6.59% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.99% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.40% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.99% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.80% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.80% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.20% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.20% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.20% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.60% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.60% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.60% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.60% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.60% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.60% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.60% |
| Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.60% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.60% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.60% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000517 | Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 3 | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300002138 | M3t6FKB1 (102f) | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004802 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006122 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013086 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020714 | Freshwater microbial communities from Trout Bog Lake, WI - 14NOV2007 epilimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025744 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| PR_CR_10_Liq_3_inCRDRAFT_10471473 | 3300000517 | Enviromental | IDPSKIVATLTAAIQEQQAQIEALQAEVQALKDKA* |
| Draft_102088081 | 3300001605 | Hydrocarbon Resource Environments | KDEVDAEGKPKYQGVDTSFLVATLTAAIQEQQVLIDQLKGRLDAANL* |
| Draft_103901452 | 3300001605 | Hydrocarbon Resource Environments | AVDADGKPQYQGIDVSFLVATLTAAIQEQQALITQLQADVAALKAK* |
| RCM30_11070511 | 3300001842 | Marine Plankton | PKYQGIDTSFLVATLTAALQEMKAIIDDQAARIQALENK* |
| M3t6FKB1_139656624 | 3300002138 | Marine | MLPRYQGIDTSFLVATLTAAIQEQQAIITALTTRITALEAK* |
| B570J29032_1096126913 | 3300002408 | Freshwater | GKPQYQGIDTSFLVATLTAAIQELKAIVDAQAVRIAALEIK* |
| B570J40625_1005133544 | 3300002835 | Freshwater | KPQYQGIDTSFLVATLTAAIQELKAIVDAQAVRIAALEIK* |
| Water_1042055 | 3300002930 | Estuary Water | DKDGKPVYQGMDTSHLVATLVAAIQEQQALIESLTTRLTALENK* |
| JGI25909J50240_11214252 | 3300003393 | Freshwater Lake | GNIKPQGIDTSFLVATLTAAIQEQQAIIESLKARLDAANL* |
| Ga0007829_100532233 | 3300004095 | Freshwater | NEDGTPKYQGVDTSFLVATLTAAIQEQQALITDLQARLTKAGL* |
| Ga0066180_101721072 | 3300004128 | Freshwater Lake | AVDDEGNPKYQGIDTSFLVATLTAAIKEQQALITQLTERITALEAK* |
| Ga0007794_100668213 | 3300004774 | Freshwater | NPQYQGIDTSFLVATLTCAIQELKAIIDLQATRISALESKIV* |
| Ga0007801_101586501 | 3300004802 | Freshwater | IRPQGVDTAKLVAILVAAMQEQQAVIEALIARIVALESK* |
| Ga0049083_100729593 | 3300005580 | Freshwater Lentic | QGIDTSFLVATLTAAIQEQQALITALTTRITALENNNATQ* |
| Ga0049084_102567302 | 3300005585 | Freshwater Lentic | TSFLVATLTAAIQEQQALITQLQTQITALNAKVGI* |
| Ga0007870_11184502 | 3300006109 | Freshwater | QGIDTSYLVATLTAAIQEQQALITDLQARLTKAGL* |
| Ga0007816_10178804 | 3300006115 | Freshwater | DGKPIYQGVDTSFLVATLTAAIQEQQTIINDLKARITALEGAK* |
| Ga0007837_10631843 | 3300006122 | Freshwater | YQGVDTSFLVATLTAAIQEQQALITDLQARLTKAGL* |
| Ga0007828_10767942 | 3300006128 | Freshwater | KPVYQGIDTSFLVATLTSAIQELNTLVNAQAAEITALKAKVGV* |
| Ga0070749_100263991 | 3300006802 | Aqueous | QGIDTSFLVATLTAAIQEQQAIIESLKARLDAANL* |
| Ga0075464_107668781 | 3300006805 | Aqueous | KDGIDAHGNPDYQGVDASFLIATLTAAIQEQQALIEELKTRVTALENT* |
| Ga0075459_10968121 | 3300006863 | Aqueous | IDTSFLVATLTAAIKEQQAMIQEQSATIASLTARIEALEAA* |
| Ga0075473_103243873 | 3300006875 | Aqueous | GNPKYQGIDTSFLIATLTAAIKELKEIVDTQAAKIAVLEQA* |
| Ga0075444_104123602 | 3300006947 | Marine | KHQGVDTSFLVATLTAAIQEQQVIIEALTTRITALEG* |
| Ga0099851_13089721 | 3300007538 | Aqueous | QYQGIDTSFLVATITAAIQEQQAIIESLKARLDAANL* |
| Ga0102919_10611242 | 3300007597 | Estuarine | YQGVDTSFLVATLTKAIQEQQALIESLTTRLTALEGK* |
| Ga0070751_12206141 | 3300007640 | Aqueous | PQYQGVDTSFLVATLTAAIQELKAENDALKARLDAANL* |
| Ga0105747_12142131 | 3300007974 | Estuary Water | PVYQGIDVSFLVATLTAAIQEQQALIVSLTARIATLEAK* |
| Ga0105748_103390411 | 3300007992 | Estuary Water | QSVDTSFLVATLVSAIQEQQALIESLTTRLTALESK* |
| Ga0114841_12690552 | 3300008259 | Freshwater, Plankton | DTSFLVATLTAAIQEQQALITQLQADVAELKGRP* |
| Ga0114364_10489511 | 3300008267 | Freshwater, Plankton | MGTRTVPSYQGVDTSFLIATLTAAIQEQQALITALTTRITALEAA* |
| Ga0114364_11041235 | 3300008267 | Freshwater, Plankton | PQGIDTSFLVATLTAAIQEQQALITQLTARITALESA* |
| Ga0114876_10244867 | 3300008448 | Freshwater Lake | VPQGIDTSFLVATLTAAIQEQQALITSLTARIAALEGATQ* |
| Ga0114876_10509541 | 3300008448 | Freshwater Lake | QGIDTSFLVATLTAAIQEQQALIAALQADVAALKGAQA* |
| Ga0114880_101148411 | 3300008450 | Freshwater Lake | GIDTSFLVATLTAALQEAHSLIKNLETRISALEAK* |
| Ga0114880_10616954 | 3300008450 | Freshwater Lake | YQGIDTSFLSATLAAAIQELHQIVQAQAAEIAELKANLP* |
| Ga0114973_104443701 | 3300009068 | Freshwater Lake | GKPIYQGIDTNCVVTSLTAAIQEQQALITSLTARITALEST* |
| Ga0105098_107691913 | 3300009081 | Freshwater Sediment | VDTSFLVATLTAAIQEQQAIITQLQADVAALKAAA* |
| Ga0114962_103499131 | 3300009151 | Freshwater Lake | QGVDTSFLVATLTAAIQEQQALITSLTARITALEAR* |
| Ga0114962_104823961 | 3300009151 | Freshwater Lake | VDAEGNPQYQGIDTSFLVATLTAAIQEQQAFITSLTTRITALENK* |
| Ga0114968_100041321 | 3300009155 | Freshwater Lake | PKYQGMDTSHLVATLVSAIQEQQALIESLTTRLTALENK* |
| Ga0114978_105356871 | 3300009159 | Freshwater Lake | YQGIDTSFLVATLTAAIQEQQALIQDLTTRLAALEAK* |
| Ga0114981_107428583 | 3300009160 | Freshwater Lake | HQGVDTSFLVATLTAAIQEQQALIESLTTRLTALENK* |
| Ga0114966_102410254 | 3300009161 | Freshwater Lake | YQGIDTSFLVATLTAAIQEQQTLIESLTARLTALENK* |
| Ga0114966_105122631 | 3300009161 | Freshwater Lake | GIDTSFLVATLTAAIQEQQAIIENLTTRLVALEAK* |
| Ga0114975_106074323 | 3300009164 | Freshwater Lake | DGSPKHQGIDTSFLVATLTAAIQEQQALITSLTARITALEAK* |
| Ga0105096_104607541 | 3300009170 | Freshwater Sediment | QGIDVSFLVATLTAAIQEQQAIIESLKARLDAANL* |
| Ga0114979_104417501 | 3300009180 | Freshwater Lake | KDGNPKYQGIDTSFLVATLTAAIQEQQTLITQLTARITALESA* |
| Ga0114958_102656163 | 3300009684 | Freshwater Lake | SIKSQGIDTSFLVATLTAAIQEQQALIQSLTDRVAQLEAK* |
| Ga0114967_104778941 | 3300010160 | Freshwater Lake | YQGIDTSFLVATLTAAIQEQQALITQLTARITALEGA* |
| Ga0129333_101401181 | 3300010354 | Freshwater To Marine Saline Gradient | DAEGKPQYQGIDTSFLVATLTAAIKEQQAIIEQLTTRITALEAK* |
| Ga0114986_10513973 | 3300010374 | Deep Subsurface | QGIDTSFLVATLTAAIQEQQTIIESLKARLDAANL* |
| Ga0133913_127345111 | 3300010885 | Freshwater Lake | QGIDTSFLVATLTAAIQEQQALITSLTARITALEGA* |
| Ga0153799_10859791 | 3300012012 | Freshwater | GIDTSFLVATLTAAIQEQQAMIEELKAKVVALEGAA* |
| Ga0164292_109817061 | 3300013005 | Freshwater | PQYQGIDTSFLVATLTAAIQEQQALITALTARITALENK* |
| Ga0163202_11555722 | 3300013086 | Freshwater | AVDEKGDPKYQQVDVSFLVATLTAAIQEQQALITALTARITALENKT* |
| Ga0177922_111035003 | 3300013372 | Freshwater | FLVATLTAAIQEQQALITSLTTRITALEGANNGS* |
| Ga0119960_10435871 | 3300014811 | Aquatic | MGEREVPKYQGIDTSFLVATLTAAIQEQQAIITALTTRITAL |
| Ga0181338_10400621 | 3300015050 | Freshwater Lake | NGQEFIVPQGIDTSFLVATLTAAIQEQQALIQSLKARLDAANL* |
| Ga0181350_11299581 | 3300017716 | Freshwater Lake | IDTSFLVATLTAAIQEQQALITQLQADVASLKGASA |
| Ga0181347_11189181 | 3300017722 | Freshwater Lake | KYQGIDTSFLVATLTAAIQEQQALITQLQADVAALKAQ |
| Ga0181347_11501953 | 3300017722 | Freshwater Lake | GDIKSQGIDTSFLVATLTAAIQEQQALITALTTRITALENN |
| Ga0181362_10204761 | 3300017723 | Freshwater Lake | TKIKPQGIDTSFLVATLTAAIQEQQALITALTTRITALEAA |
| Ga0181362_10407831 | 3300017723 | Freshwater Lake | QHQGIDTSFLVATLTAAIQELKAVVDAQAARITALESAP |
| Ga0181362_10548821 | 3300017723 | Freshwater Lake | NEQTRPNYQGIDTSFLVATLTAAIQELKAEVDSLKAQINGASA |
| Ga0181365_11266652 | 3300017736 | Freshwater Lake | DTSFLVATLTAAIQEQQALITSLTARIAALEGTPA |
| Ga0181344_11336051 | 3300017754 | Freshwater Lake | KQGVDSSFLVATLTAAIQEQQALIVALTARIDALEAK |
| Ga0181344_11413623 | 3300017754 | Freshwater Lake | DAEGNPEYQGIDTSFLVATLTAAIQEQQAIINDLKARIETLESK |
| Ga0181356_12473312 | 3300017761 | Freshwater Lake | DADGNPAYQGIDTSFLVATLTAAIQEQQALITSLTARIVALELT |
| Ga0181356_12492633 | 3300017761 | Freshwater Lake | TPKYQGIDTSFLVATLTAAIQEQQAIILSLKARLDAANL |
| Ga0181358_10023701 | 3300017774 | Freshwater Lake | TKIKPQGIDTSFLVATLTAAIQELKAIVDTQAARITALEAA |
| Ga0181358_11095351 | 3300017774 | Freshwater Lake | VDAEGKPKYQGIDTSFLVATLTAAIQEQQALITQLQTQITALNAKVGI |
| Ga0181358_12281233 | 3300017774 | Freshwater Lake | IHQGIDTSFLVATLTAAIQEQQALITALTARITALESI |
| Ga0181358_12718081 | 3300017774 | Freshwater Lake | VNAEGNSEYQGIDTSFLVATLTAAIQEQQALITALTTRITALEGAAA |
| Ga0181357_11469344 | 3300017777 | Freshwater Lake | SIKPQGIDTSFLVATLTAAIQEQQALITQLTARITALESA |
| Ga0181357_12768181 | 3300017777 | Freshwater Lake | RPIHQGIDTSFLVATLTAAIQEQQALITALTARITALESI |
| Ga0181357_13037652 | 3300017777 | Freshwater Lake | RYQGIDVSFLVATLTAAIQEQQALITSLTARIAALEA |
| Ga0181357_13323111 | 3300017777 | Freshwater Lake | SEYQGIDTSFLVATLTAAIQEQQALITALTTRITALEGAAA |
| Ga0181349_12041381 | 3300017778 | Freshwater Lake | RQGVDTSFLVATLTAAIQEQQALITQLTARITALETP |
| Ga0181349_12097083 | 3300017778 | Freshwater Lake | VDTSFLVATLTAAIQEQQAIINALEARLTALEAKP |
| Ga0181346_10227991 | 3300017780 | Freshwater Lake | AVDAEGNPRYQGVDTSFLVATLTAAIQEQQALITQLTARITALEAA |
| Ga0181346_12430971 | 3300017780 | Freshwater Lake | NGDIKSQGIDTSFLVATLTAAIQEQQALITALTTRITALENN |
| Ga0181346_13331292 | 3300017780 | Freshwater Lake | PKYQGVDTSFLVATLTAAIQEQQALITSLTARITALEGA |
| Ga0181348_11775941 | 3300017784 | Freshwater Lake | GSIKSQGIDTSFLVAILTAAMQEQQALITQLTARITALETS |
| Ga0181348_12206973 | 3300017784 | Freshwater Lake | GSIKPQGIDTSFLVATLTAAIQEQQALITQLTARITALESA |
| Ga0181348_12313291 | 3300017784 | Freshwater Lake | TGTEVRPIHQGIDTSFLVATLTAAIQEQQALITALTARITALESI |
| Ga0181348_12420312 | 3300017784 | Freshwater Lake | KPQGIDTSFLVATLTAAIQEQQALITSLTARITALEGA |
| Ga0181348_12721771 | 3300017784 | Freshwater Lake | KPRYQGVDTSFLVATLTAAIQEQQVMINELMAKVAALESK |
| Ga0181355_11679702 | 3300017785 | Freshwater Lake | GVDTSFSVATVVKGMQEQQAIIATLEARIAALEAK |
| Ga0181355_13538442 | 3300017785 | Freshwater Lake | GNPQYQGIDTSFLVATLTAAIQEQQALITALTTRITALEGAAA |
| Ga0181359_10987113 | 3300019784 | Freshwater Lake | QGIDTSFLVATLTAAIQEQQALITALTTRITALEGAAA |
| Ga0214182_10323921 | 3300020714 | Freshwater | GIDTSFLVATLTAAIQEQQALITDLTTRLTALEGK |
| Ga0214165_10967471 | 3300021137 | Freshwater | EGKPIYQGIDTSFLVATLTAAIQEQQAIITDLKTRIETLEAK |
| Ga0214192_11028561 | 3300021142 | Freshwater | VDDEGNPKYQGIDTSFLVATLVSAIQEQQAIIEQLKTKIL |
| Ga0222714_100604185 | 3300021961 | Estuarine Water | AEGNPLHQGIDTSFLVATLTAAIQEQQAIIESLKADVAILKGVQP |
| Ga0222712_104058982 | 3300021963 | Estuarine Water | IDTSFLVATLTAAIQEQQALITSLTARITALENKT |
| Ga0222712_104200864 | 3300021963 | Estuarine Water | DEEGKPQYQGIDTSFLVATLTAAIKEQQALIEQLTTRIAALEAK |
| Ga0181353_10716531 | 3300022179 | Freshwater Lake | GKPVYQGIDTSFLVATLTAAIQEQQAMINELKAEVAALKGA |
| Ga0181354_12056113 | 3300022190 | Freshwater Lake | GVTPKYQGIDTSFLVATLTAAIQEQQAIILSLKARLDAANL |
| Ga0196905_11537401 | 3300022198 | Aqueous | NPVYQGIDTSFLVATLTKAIQEQQTIIEDLKTRVSTLEGN |
| Ga0181351_12462341 | 3300022407 | Freshwater Lake | KDAVHKDGKPKYQGVDTSFLVATLVSAIQEQQALIESLTTRLTALENK |
| Ga0181351_12537831 | 3300022407 | Freshwater Lake | EYQGVDTSFLVATLTAAIQEQQTIINDLKARVETLEAK |
| (restricted) Ga0233412_101378521 | 3300023210 | Seawater | AIPVYQGVDLSKMVPILTAAIQEQQVLINDLTARIEALEG |
| Ga0244777_103786533 | 3300024343 | Estuarine | QGIDTSFLVATLTAAIQEQNVLIQSLKARLDAANL |
| Ga0255280_11256891 | 3300024555 | Freshwater | SIKPQGIDTSFLVATLTAAIQEQQQMIETLQAKVAALEAK |
| Ga0208382_10297951 | 3300025369 | Freshwater | KDDVSDTGQIKSQAVDPSKIVATLVLAVQEQQALIESLTTRLTALENK |
| Ga0208616_10453242 | 3300025417 | Freshwater | VDAEGKPVYQGVDTSFLVATLTAAIQEQQTIINDLKARIETLEAK |
| Ga0208746_10243422 | 3300025423 | Freshwater | AVDAEGKPVYQGIDTSFLVATLTAAIQEQQALITTLQTQVAAIQAKVGA |
| Ga0208147_10746831 | 3300025635 | Aqueous | AVDAEGKPQYQGVDTSFLVATLVAAIKEQQAIIEQLTTRIEALEQQP |
| Ga0209136_11632653 | 3300025636 | Marine | PQYQQMDHSTLVPLLTAAIQEQQATITALTDRITALENA |
| Ga0208784_12002921 | 3300025732 | Aqueous | YQGIDVSFLVATLTAAIQEQQAMIESLKARLDAANL |
| Ga0255245_10167762 | 3300025744 | Freshwater | QYQGVDTSFLVATLVAAIKEQQAIITALTARITALEAN |
| Ga0208916_102172781 | 3300025896 | Aqueous | DTSFLIATLSAAIQEQQTIITALTARITALEGAAA |
| Ga0255270_10561971 | 3300026572 | Freshwater | DGSIKPQGIDTSFLVATLTAAIQEQQQMIETLQAKVAALEAK |
| Ga0208800_10553793 | 3300027193 | Estuarine | LDANGNIKPQGIDVSFLVATLTAAIQEQQALIESLTTRLTALENK |
| Ga0255079_11063201 | 3300027601 | Freshwater | YQGIDTSFLVATLTAAIKEQQAMINELKAEVAALKGA |
| Ga0208951_10961641 | 3300027621 | Freshwater Lentic | AVDADGKPQYQGIDTSFLVATLTAAIQEQQALITALTTRITALEAA |
| Ga0208960_10730581 | 3300027649 | Freshwater Lentic | TSFLVATLTAAIQEQQALITQLQTQITALNAKVGI |
| Ga0209297_10217997 | 3300027733 | Freshwater Lake | DGNPKYQGIDTSFLVATLTAAIQEQQALITTLTDRITALEAK |
| Ga0209297_12505403 | 3300027733 | Freshwater Lake | PQYQGVDTSFLVATLTAAIQEQQALITSLTTRLTALENK |
| Ga0209084_13699102 | 3300027749 | Freshwater Lake | GVDTSFLVATLTAAIQEQQALITSLTARITALEAR |
| Ga0209246_101610921 | 3300027785 | Freshwater Lake | NDENPKYQQVDTSFLVATLTAAIQEQQALITALTARITALEN |
| Ga0209353_101217564 | 3300027798 | Freshwater Lake | PEYQGIDTSFLVATLTAAIQEQQALITALTTRITALEAA |
| Ga0209353_103093611 | 3300027798 | Freshwater Lake | VDEEGNPQYQGIDTSFLIATLSAAIQELHALVKTQAQDIADLKAKLP |
| Ga0209353_103443703 | 3300027798 | Freshwater Lake | QGIDTSFLVATLTAAIQEQQALITSLTARITALEST |
| Ga0209353_103470463 | 3300027798 | Freshwater Lake | AVDADGKPQYQGIDTSFLVATLTAAIQEQQALITQLTARLDAANL |
| Ga0209353_103907301 | 3300027798 | Freshwater Lake | DTSFLVATLTAAIQEQQALITALTTRITALEGAAA |
| Ga0247723_10441374 | 3300028025 | Deep Subsurface Sediment | GVDTSFLVATLTAAIQEQQALITSLTTRITALETK |
| Ga0256305_11018603 | 3300028108 | Freshwater | PQYQGIDTSYLVATLTAAIQEQQAFITTLTARITALEGA |
| Ga0304729_10515521 | 3300028392 | Freshwater Lake | GIDYSRFVPFLTAAIQEQQALITSLTDRIAALEAR |
| Ga0304728_11860601 | 3300028393 | Freshwater Lake | PKHQGIDVSFLVSTLTAAIQEQQALITSLTDRIVALEAK |
| Ga0304728_12730612 | 3300028393 | Freshwater Lake | NPKYQGIDVSFLVATLTAAIQEQQTLITALTARVGMLEEIIKGST |
| Ga0304730_12521523 | 3300028394 | Freshwater Lake | VYQGVDTSFLVATLVSAIQEQQALIESLTTRLTALENK |
| Ga0307377_105515172 | 3300031673 | Soil | FLVATLTAAIQEQQALITGQQAMLASLTARIEALENK |
| Ga0315291_111006903 | 3300031707 | Sediment | QGIDTSFLVATLTAAIQEMKAIIDAQSARITALENK |
| Ga0315293_111680971 | 3300031746 | Sediment | QGVDTSFLVATLTKAIQEQQALIESLTTRLTALENK |
| Ga0315907_100656271 | 3300031758 | Freshwater | SIKPQGIDTSFLVATLTAAIKEQQQMIETLQAKVAALEAK |
| Ga0315909_104350251 | 3300031857 | Freshwater | IDTSFLVATLTAAIQEQQAIIESLTARVVALEGAQIV |
| Ga0315285_102839571 | 3300031885 | Sediment | TSFLIATLSAAIQELHALVKTQDSTITALTTRITALEAA |
| Ga0315904_102880314 | 3300031951 | Freshwater | YQGIDTSFLSATLAAAIQELHQIVQAQAAEIAELKANLP |
| Ga0315904_104369862 | 3300031951 | Freshwater | DDEGNPVYQGIDTSFLVATLTAAIQEQQALITQLQADVAALKGA |
| Ga0315904_114549821 | 3300031951 | Freshwater | YQGIDTSFLVATLTAAIQEQQAIIESLTARVAALEQP |
| Ga0315294_105989891 | 3300031952 | Sediment | DADGKPKYQGIDTSFLVATLTKAIQEQQALIESLTTRLTNLENK |
| Ga0315294_107180284 | 3300031952 | Sediment | QGIDTSFLVATLTAAIQEQQAIIETMRTEIDALKAKVGT |
| Ga0315294_116213932 | 3300031952 | Sediment | QGIDTSFLVATLTAAIQEQQALITTLTERITALEGV |
| Ga0316218_11443853 | 3300032117 | Freshwater | MASLVLNGKPKYQGIDTSFLVATLTAALQEAHGLIKDLEARLVVLESK |
| Ga0315295_106682781 | 3300032156 | Sediment | DAVDADGKPVHQGIDTSFLVATLTAAIQEQQALITALTARITALEAK |
| Ga0315295_114888091 | 3300032156 | Sediment | AEMDTRTVPVYQMVDTSFLVATLTAAIQEQQALITTLTARISALESA |
| Ga0315268_126807751 | 3300032173 | Sediment | QGIDTSFLVATLTAALQEAHGLIKDLTTRITASESK |
| Ga0315270_102503751 | 3300032275 | Sediment | GKPQYQGIDTIFLVDILTAALQEQQAIIETLKARLDAANL |
| Ga0315275_124445531 | 3300032401 | Sediment | QGIDTSFLVATLTAAIQEQQAMIESLRQRLSAANL |
| Ga0315275_125688061 | 3300032401 | Sediment | VHQGIDTSFLVATLTAAIQEQQALITSLTARITALEST |
| Ga0315273_116582734 | 3300032516 | Sediment | PQYQGMDTSFLIATLVSAIQEQQALIESLTTRLSALENK |
| Ga0316617_1027778352 | 3300033557 | Soil | AEGKPQYQGIDTSFLVATLTAAIQEQQALITALTARVALLEGN |
| Ga0334979_0607902_2_157 | 3300033996 | Freshwater | DADGNVTGTEERPVYQGIDTSFLVAMLTAAIQEQQALITSLTARITALEAK |
| Ga0334985_0231756_2_127 | 3300034018 | Freshwater | KGNPKYQGIDTSFLVATLTAAIQEQQAIIESLKARLDAANL |
| Ga0334990_0558453_473_604 | 3300034068 | Freshwater | TEERPVYQGIDTSFLVAMLTAAIQEQQALITSLTSRITALESI |
| Ga0335010_0312454_774_896 | 3300034092 | Freshwater | VPAYQGVDTSFLVATLTAAMQEQQAIITALTARIVALEAK |
| Ga0335027_0574321_581_691 | 3300034101 | Freshwater | GVDTSFLVATLTAAIKEQQALITQLQLDVAALKGAA |
| Ga0335031_0481808_1_114 | 3300034104 | Freshwater | QGVDTSFLVATLTAAIQEQQQIINDLKARIETLEGAK |
| Ga0335066_0336513_724_840 | 3300034112 | Freshwater | IHQGIDTSFLVATLTAALQEAHGLIKDLQSRVDALEAK |
| Ga0335033_0426679_3_122 | 3300034117 | Freshwater | RPQGVDTSFLVATLTAAIQEQQAMIVQLQADVAALKSTN |
| Ga0335053_0066576_2413_2535 | 3300034118 | Freshwater | VPKYQGIDTSFLVATLTAAIQEQQALITALTTRITALEAA |
| Ga0335054_0441762_618_737 | 3300034119 | Freshwater | NPKYQGIDTSFLVATLTAAIQEQQAIIESLKARLDAANL |
| Ga0335054_0530398_503_625 | 3300034119 | Freshwater | VHQGIDTSFLVATLTAAIQEQQALITQLQADVATLKALKA |
| Ga0335058_0238189_2_127 | 3300034121 | Freshwater | EVNGLYGLDKSGLVPVLIKAIQEQQALITQLTARITALEGA |
| Ga0335007_0228221_1_120 | 3300034283 | Freshwater | PVYQGIDTSFLVATLTAAIQEQQAMIDELKAKVAALEAA |
| ⦗Top⦘ |