| Basic Information | |
|---|---|
| Family ID | F037200 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGT |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.39 % |
| % of genes near scaffold ends (potentially truncated) | 98.21 % |
| % of genes from short scaffolds (< 2000 bps) | 89.88 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.429 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (39.881 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.690 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 15.94% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF11651 | P22_CoatProtein | 1.79 |
| PF13385 | Laminin_G_3 | 1.19 |
| PF06035 | Peptidase_C93 | 0.60 |
| PF13884 | Peptidase_S74 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.57 % |
| Unclassified | root | N/A | 46.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2222084003|2222363527 | Not Available | 510 | Open in IMG/M |
| 2236876002|none_p009786 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10091298 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10184543 | Not Available | 681 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10153991 | Not Available | 755 | Open in IMG/M |
| 3300001963|GOS2229_1051098 | All Organisms → Viruses → Predicted Viral | 1700 | Open in IMG/M |
| 3300004829|Ga0068515_112338 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300004941|Ga0068514_1051009 | Not Available | 508 | Open in IMG/M |
| 3300006025|Ga0075474_10068447 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300006026|Ga0075478_10156373 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300006026|Ga0075478_10197383 | Not Available | 615 | Open in IMG/M |
| 3300006029|Ga0075466_1018559 | Not Available | 2277 | Open in IMG/M |
| 3300006029|Ga0075466_1039035 | All Organisms → Viruses → Predicted Viral | 1445 | Open in IMG/M |
| 3300006637|Ga0075461_10136739 | All Organisms → Viruses | 755 | Open in IMG/M |
| 3300006637|Ga0075461_10201631 | Not Available | 595 | Open in IMG/M |
| 3300006802|Ga0070749_10024292 | All Organisms → Viruses → Predicted Viral | 3819 | Open in IMG/M |
| 3300006802|Ga0070749_10377309 | Not Available | 785 | Open in IMG/M |
| 3300006802|Ga0070749_10460987 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 695 | Open in IMG/M |
| 3300006810|Ga0070754_10340666 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 665 | Open in IMG/M |
| 3300006810|Ga0070754_10477462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300006868|Ga0075481_10020598 | All Organisms → Viruses → Predicted Viral | 2606 | Open in IMG/M |
| 3300006870|Ga0075479_10309037 | Not Available | 619 | Open in IMG/M |
| 3300006916|Ga0070750_10099102 | All Organisms → Viruses → Predicted Viral | 1352 | Open in IMG/M |
| 3300006916|Ga0070750_10215933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 843 | Open in IMG/M |
| 3300006916|Ga0070750_10277280 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 722 | Open in IMG/M |
| 3300006916|Ga0070750_10339143 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006920|Ga0070748_1240166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 654 | Open in IMG/M |
| 3300006925|Ga0098050_1063768 | Not Available | 958 | Open in IMG/M |
| 3300007234|Ga0075460_10210292 | Not Available | 659 | Open in IMG/M |
| 3300007276|Ga0070747_1056664 | All Organisms → Viruses → Predicted Viral | 1493 | Open in IMG/M |
| 3300007276|Ga0070747_1276708 | Not Available | 580 | Open in IMG/M |
| 3300007276|Ga0070747_1304153 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 548 | Open in IMG/M |
| 3300007344|Ga0070745_1271630 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 609 | Open in IMG/M |
| 3300007345|Ga0070752_1091588 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300007345|Ga0070752_1205200 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300007346|Ga0070753_1126351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 981 | Open in IMG/M |
| 3300007539|Ga0099849_1238264 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 672 | Open in IMG/M |
| 3300007540|Ga0099847_1041780 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300007609|Ga0102945_1051954 | Not Available | 798 | Open in IMG/M |
| 3300007992|Ga0105748_10442708 | Not Available | 564 | Open in IMG/M |
| 3300008050|Ga0098052_1134741 | Not Available | 986 | Open in IMG/M |
| 3300008219|Ga0114905_1191167 | Not Available | 664 | Open in IMG/M |
| 3300009001|Ga0102963_1327104 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 602 | Open in IMG/M |
| 3300009124|Ga0118687_10196548 | Not Available | 734 | Open in IMG/M |
| 3300009435|Ga0115546_1078779 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300009508|Ga0115567_10542777 | Not Available | 705 | Open in IMG/M |
| 3300010149|Ga0098049_1068690 | All Organisms → Viruses → Predicted Viral | 1121 | Open in IMG/M |
| 3300010149|Ga0098049_1093317 | All Organisms → Viruses | 944 | Open in IMG/M |
| 3300010297|Ga0129345_1194599 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010316|Ga0136655_1057664 | Not Available | 1205 | Open in IMG/M |
| 3300010316|Ga0136655_1215105 | Not Available | 572 | Open in IMG/M |
| 3300010318|Ga0136656_1153210 | Not Available | 788 | Open in IMG/M |
| 3300010368|Ga0129324_10047746 | All Organisms → Viruses → Predicted Viral | 1968 | Open in IMG/M |
| 3300010368|Ga0129324_10175447 | Not Available | 881 | Open in IMG/M |
| 3300010368|Ga0129324_10237896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300010368|Ga0129324_10254600 | Not Available | 699 | Open in IMG/M |
| 3300010392|Ga0118731_106191607 | Not Available | 702 | Open in IMG/M |
| 3300011118|Ga0114922_11665044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter spanius | 512 | Open in IMG/M |
| 3300012528|Ga0129352_10629727 | Not Available | 2278 | Open in IMG/M |
| 3300012528|Ga0129352_11013799 | Not Available | 615 | Open in IMG/M |
| 3300017697|Ga0180120_10050035 | All Organisms → Viruses → Predicted Viral | 1886 | Open in IMG/M |
| 3300017719|Ga0181390_1047862 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300017741|Ga0181421_1137166 | Not Available | 633 | Open in IMG/M |
| 3300017743|Ga0181402_1146797 | Not Available | 598 | Open in IMG/M |
| 3300017746|Ga0181389_1013775 | All Organisms → Viruses → Predicted Viral | 2623 | Open in IMG/M |
| 3300017746|Ga0181389_1070078 | Not Available | 996 | Open in IMG/M |
| 3300017764|Ga0181385_1145911 | Not Available | 719 | Open in IMG/M |
| 3300017770|Ga0187217_1032456 | All Organisms → Viruses → Predicted Viral | 1847 | Open in IMG/M |
| 3300017772|Ga0181430_1208009 | Not Available | 557 | Open in IMG/M |
| 3300017773|Ga0181386_1111862 | Not Available | 847 | Open in IMG/M |
| 3300017786|Ga0181424_10024475 | All Organisms → Viruses → Predicted Viral | 2617 | Open in IMG/M |
| 3300017818|Ga0181565_10730739 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 626 | Open in IMG/M |
| 3300017824|Ga0181552_10311060 | Not Available | 774 | Open in IMG/M |
| 3300017949|Ga0181584_10232484 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
| 3300017951|Ga0181577_10090937 | All Organisms → Viruses → Predicted Viral | 2121 | Open in IMG/M |
| 3300017951|Ga0181577_10127498 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
| 3300017951|Ga0181577_10383173 | Not Available | 897 | Open in IMG/M |
| 3300017951|Ga0181577_10777531 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 578 | Open in IMG/M |
| 3300017958|Ga0181582_10192043 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
| 3300017964|Ga0181589_10602791 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 698 | Open in IMG/M |
| 3300017967|Ga0181590_11132084 | Not Available | 503 | Open in IMG/M |
| 3300017986|Ga0181569_10341188 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300018039|Ga0181579_10230548 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300018041|Ga0181601_10240949 | Not Available | 1034 | Open in IMG/M |
| 3300018416|Ga0181553_10490666 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 657 | Open in IMG/M |
| 3300018417|Ga0181558_10068682 | All Organisms → Viruses → Predicted Viral | 2303 | Open in IMG/M |
| 3300018417|Ga0181558_10691854 | Not Available | 520 | Open in IMG/M |
| 3300018418|Ga0181567_10440482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter spanius | 859 | Open in IMG/M |
| 3300019283|Ga0182058_1466155 | Not Available | 709 | Open in IMG/M |
| 3300019732|Ga0194014_1053355 | Not Available | 569 | Open in IMG/M |
| 3300019740|Ga0193988_1068719 | Not Available | 554 | Open in IMG/M |
| 3300019754|Ga0193956_1098230 | Not Available | 565 | Open in IMG/M |
| 3300019765|Ga0194024_1091109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes | 693 | Open in IMG/M |
| 3300020054|Ga0181594_10180114 | Not Available | 1079 | Open in IMG/M |
| 3300020174|Ga0181603_10090769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 1441 | Open in IMG/M |
| 3300020182|Ga0206129_10327109 | Not Available | 605 | Open in IMG/M |
| 3300020188|Ga0181605_10439027 | Not Available | 508 | Open in IMG/M |
| 3300020194|Ga0181597_10039014 | All Organisms → Viruses → Predicted Viral | 3133 | Open in IMG/M |
| 3300020207|Ga0181570_10424504 | Not Available | 631 | Open in IMG/M |
| 3300020207|Ga0181570_10434116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 621 | Open in IMG/M |
| 3300021356|Ga0213858_10236203 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 882 | Open in IMG/M |
| 3300021368|Ga0213860_10399746 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 595 | Open in IMG/M |
| 3300021379|Ga0213864_10140861 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
| 3300021379|Ga0213864_10508699 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 602 | Open in IMG/M |
| 3300021425|Ga0213866_10175374 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300021958|Ga0222718_10618201 | Not Available | 506 | Open in IMG/M |
| 3300021964|Ga0222719_10530142 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 700 | Open in IMG/M |
| 3300021964|Ga0222719_10557436 | Not Available | 675 | Open in IMG/M |
| 3300021964|Ga0222719_10745654 | Not Available | 546 | Open in IMG/M |
| 3300022067|Ga0196895_1016681 | Not Available | 807 | Open in IMG/M |
| 3300022067|Ga0196895_1021367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus | 721 | Open in IMG/M |
| 3300022067|Ga0196895_1033240 | Not Available | 590 | Open in IMG/M |
| 3300022068|Ga0212021_1134304 | Not Available | 506 | Open in IMG/M |
| 3300022159|Ga0196893_1017199 | Not Available | 656 | Open in IMG/M |
| 3300022159|Ga0196893_1019314 | Not Available | 625 | Open in IMG/M |
| 3300022168|Ga0212027_1034804 | Not Available | 661 | Open in IMG/M |
| 3300022168|Ga0212027_1053257 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 504 | Open in IMG/M |
| 3300022169|Ga0196903_1031711 | Not Available | 624 | Open in IMG/M |
| 3300022176|Ga0212031_1089703 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 525 | Open in IMG/M |
| 3300022183|Ga0196891_1080507 | Not Available | 577 | Open in IMG/M |
| 3300022198|Ga0196905_1047274 | All Organisms → Viruses → Predicted Viral | 1235 | Open in IMG/M |
| 3300022200|Ga0196901_1044269 | Not Available | 1685 | Open in IMG/M |
| 3300022934|Ga0255781_10393816 | Not Available | 591 | Open in IMG/M |
| 3300023110|Ga0255743_10101902 | All Organisms → Viruses → Predicted Viral | 1708 | Open in IMG/M |
| 3300023116|Ga0255751_10132861 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
| 3300023176|Ga0255772_10393041 | Not Available | 701 | Open in IMG/M |
| 3300023178|Ga0255759_10149437 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300023180|Ga0255768_10622832 | Not Available | 518 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10115963 | All Organisms → Viruses → Predicted Viral | 1364 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10510199 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 558 | Open in IMG/M |
| 3300025085|Ga0208792_1090083 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 540 | Open in IMG/M |
| 3300025102|Ga0208666_1041882 | All Organisms → Viruses → Predicted Viral | 1324 | Open in IMG/M |
| 3300025543|Ga0208303_1041571 | All Organisms → Viruses → Predicted Viral | 1162 | Open in IMG/M |
| 3300025543|Ga0208303_1099039 | Not Available | 619 | Open in IMG/M |
| 3300025630|Ga0208004_1007543 | All Organisms → Viruses → Predicted Viral | 3763 | Open in IMG/M |
| 3300025652|Ga0208134_1065365 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
| 3300025674|Ga0208162_1072952 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300025674|Ga0208162_1174044 | Not Available | 569 | Open in IMG/M |
| 3300025751|Ga0208150_1044450 | All Organisms → Viruses → Predicted Viral | 1526 | Open in IMG/M |
| 3300025751|Ga0208150_1233324 | Not Available | 560 | Open in IMG/M |
| 3300025759|Ga0208899_1037470 | All Organisms → Viruses → Predicted Viral | 2201 | Open in IMG/M |
| 3300025759|Ga0208899_1081456 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300025769|Ga0208767_1110578 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300025771|Ga0208427_1130802 | Not Available | 843 | Open in IMG/M |
| 3300025803|Ga0208425_1009949 | All Organisms → Viruses → Predicted Viral | 2652 | Open in IMG/M |
| 3300025806|Ga0208545_1152698 | Not Available | 550 | Open in IMG/M |
| 3300025815|Ga0208785_1162284 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 505 | Open in IMG/M |
| 3300025840|Ga0208917_1136690 | Not Available | 864 | Open in IMG/M |
| 3300025840|Ga0208917_1167243 | Not Available | 754 | Open in IMG/M |
| 3300025880|Ga0209534_10078782 | All Organisms → Viruses → Predicted Viral | 1958 | Open in IMG/M |
| 3300025887|Ga0208544_10198628 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 830 | Open in IMG/M |
| 3300025887|Ga0208544_10359601 | Not Available | 552 | Open in IMG/M |
| 3300025889|Ga0208644_1030068 | Not Available | 3266 | Open in IMG/M |
| 3300025889|Ga0208644_1030459 | All Organisms → Viruses → Predicted Viral | 3238 | Open in IMG/M |
| 3300026453|Ga0228644_1027571 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| 3300027159|Ga0208020_1010752 | All Organisms → Viruses → Predicted Viral | 1808 | Open in IMG/M |
| 3300027752|Ga0209192_10078738 | Not Available | 1405 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10081288 | Not Available | 1051 | Open in IMG/M |
| 3300027917|Ga0209536_100621631 | All Organisms → Viruses → Predicted Viral | 1344 | Open in IMG/M |
| 3300028115|Ga0233450_10320834 | Not Available | 648 | Open in IMG/M |
| 3300028125|Ga0256368_1023453 | Not Available | 1095 | Open in IMG/M |
| 3300031519|Ga0307488_10308003 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300031539|Ga0307380_10486131 | Not Available | 1090 | Open in IMG/M |
| 3300032136|Ga0316201_10231992 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
| 3300033742|Ga0314858_100063 | Not Available | 735 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 39.88% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 18.45% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.55% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.36% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.17% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.57% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.38% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.79% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.79% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.19% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.19% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.19% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 1.19% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.19% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.60% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat | 0.60% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.60% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.60% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.60% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine | 0.60% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.60% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.60% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.60% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.60% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.60% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.60% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.60% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.60% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.60% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084003 | Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Ctl_5_microcosm | Environmental | Open in IMG/M |
| 2236876002 | Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p8-CR7-chlmax | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300004941 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-0.2um | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019732 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG | Environmental | Open in IMG/M |
| 3300019740 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_4-5_MG | Environmental | Open in IMG/M |
| 3300019745 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MG | Environmental | Open in IMG/M |
| 3300019754 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_7_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020054 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026453 | Seawater microbial communities from Monterey Bay, California, United States - 56D | Environmental | Open in IMG/M |
| 3300027159 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2222421617 | 2222084003 | Marine | MATTIITKNGSGAPLASDLVAGELAVDLTNGRLYTEDSGGSVIELGLTPSGN |
| none_0097862 | 2236876002 | Marine Estuarine | MTTIITKNGSGAPSAGQLSQGELAVDLTNKQLYSKDLGNNVVKIG |
| DelMOSum2010_100912981 | 3300000101 | Marine | MATTIVTKYGGDAPAASDIVRGELAVDTENGRLYTENSSGAVV |
| DelMOSpr2010_101845431 | 3300000116 | Marine | MATTIVTKYGSDAPAASDIVRGELAVDTENGRLYT |
| DelMOWin2010_101539913 | 3300000117 | Marine | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTE |
| GOS2229_10510983 | 3300001963 | Marine | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYT |
| Ga0068515_1123382 | 3300004829 | Marine Water | MTTIKLKNGSGAPLASDLVQGEPALDLTNKRLYTEDSLGA |
| Ga0068514_10510091 | 3300004941 | Marine Water | MTTIKLKNGSGAPTAGDLAQGEPALDLTNKRLYTEDSGGTVIEV |
| Ga0075474_100684471 | 3300006025 | Aqueous | MATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTEDSGG |
| Ga0075478_101563733 | 3300006026 | Aqueous | MATTIKLKNGTGAPSAGALVVAEPALDLTNKRLYTEDSGGTVIEV |
| Ga0075478_101973831 | 3300006026 | Aqueous | MTTIKLKNGSGAPAGGDLTQGEPALDLTNKRLYTENASGTVIEVGTNP |
| Ga0075466_10185591 | 3300006029 | Aqueous | MTTIKLKNGSGAPAASDLAQGEPALDLTNKRLYTED |
| Ga0075466_10390351 | 3300006029 | Aqueous | MTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTEDSG |
| Ga0075461_101367391 | 3300006637 | Aqueous | MATTIITKYGSGAPAASDVVRGELAVDTENKRLYTEDSGGSVVE |
| Ga0075461_102016312 | 3300006637 | Aqueous | MATTIITKYGSGAPTADDLSVGELAVDLTNKRLYSKNSSNAVIEL |
| Ga0070749_100242921 | 3300006802 | Aqueous | MASTIQLKRGSGAPTAGDLAVGEPALDLTNKRLYTEDT |
| Ga0070749_103773093 | 3300006802 | Aqueous | MATRIITKNGSGAPLASDLQQGELAVDLTNKRLYTE |
| Ga0070749_104609871 | 3300006802 | Aqueous | MASTIKLKNGSGAPTTGDLVQGEPALDLTNKRLYTEDSGGTVIEVG |
| Ga0070749_105792802 | 3300006802 | Aqueous | MATTIITKYGSGAPTADDLSVGELAVDLTNKRLYSKNSSNAVIELGVN |
| Ga0070754_103406662 | 3300006810 | Aqueous | MATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTED |
| Ga0070754_104774621 | 3300006810 | Aqueous | MATTIKLKNGSGAPTAGDLVTAEPALDLTNKRLYTEDSGGTV |
| Ga0075481_100205981 | 3300006868 | Aqueous | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGG |
| Ga0075479_103090371 | 3300006870 | Aqueous | MATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTEDSGGTVI |
| Ga0070750_100991021 | 3300006916 | Aqueous | MATTIITKYGSGAPLASDLVRGELAVDTELGRLYTETSGGAVI |
| Ga0070750_102159331 | 3300006916 | Aqueous | MASTIITKYGSGAPLASDLVRGELAVDTELGRLYTETSGGAVI |
| Ga0070750_102772802 | 3300006916 | Aqueous | MATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTENSGGTVI |
| Ga0070750_103391432 | 3300006916 | Aqueous | MATTIITKYGSGAPTASDVVRGELAVDTENKRLYTEDSGGSVVELG |
| Ga0070746_101678362 | 3300006919 | Aqueous | MATTIITKNGTGAPLASDLVAGELAVDLTNKRLYTEDSGGTIIEVGSNPSVLDVDNI |
| Ga0070748_12401663 | 3300006920 | Aqueous | MTTINLKYGSGEPSTADLVTAEPALDLTNKRLYTENT |
| Ga0098050_10637681 | 3300006925 | Marine | MATTIVTKYGGDAPAASDLVRGELAVDTENGRLYTENAA |
| Ga0075460_102102922 | 3300007234 | Aqueous | MATTIITKNGSGAPTADDLSVGELAVDLTNKRLYSKNSSSEVI |
| Ga0070747_10566641 | 3300007276 | Aqueous | MATTIVTKFGSDAPAASDIVRGELAVDTENGRLYTENAAG |
| Ga0070747_12767082 | 3300007276 | Aqueous | MATTIVTKYGSDAPAASDLVRGELAVDTENGRLYT |
| Ga0070747_13041532 | 3300007276 | Aqueous | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTENASGA |
| Ga0070745_12716301 | 3300007344 | Aqueous | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTENASGTVI |
| Ga0070752_10915881 | 3300007345 | Aqueous | MATTIVTKFGSDAPAASDIVRGELAVDTENGRLYTENAAGAVV |
| Ga0070752_12052001 | 3300007345 | Aqueous | MTTIITKNGSGAPTAGQLSEGELAVDLTNKELYTKS |
| Ga0070753_11263512 | 3300007346 | Aqueous | MATTIITKNGSGAPTADDLSVGELAVDLTNKRLYSKNSS |
| Ga0099849_12382642 | 3300007539 | Aqueous | MATTIITKSGSGAPLAGDLQVAELALDLTNKKLYSKEGTTVFEV |
| Ga0099847_10417801 | 3300007540 | Aqueous | MATTIVTKNGSGAPTASDLVAGELAVDLTNGRLYTT |
| Ga0102945_10519541 | 3300007609 | Pond Water | MASRIITKKGSGAPLASDLVHGELAVDTVNKRLYTENAGGTIIEV |
| Ga0105748_104427081 | 3300007992 | Estuary Water | MATTIVTKSGSGAPAASDLVAGELAVDLTNGRLYTEDSGGTVLE |
| Ga0098052_11347412 | 3300008050 | Marine | MTTIKLKNGSGAPTSGDLAQGEPALDLTNKRLYTEDSGGNVIEVGTN |
| Ga0114905_11911671 | 3300008219 | Deep Ocean | MATTSVTKKGSGAPAASDLVEGELAVDTTNGRLYTEN |
| Ga0102963_13271042 | 3300009001 | Pond Water | MATTIITKNGSGAPLAGDLTAGELAVDLTNKRLYSKDSGGTVIEL |
| Ga0118687_101965482 | 3300009124 | Sediment | MTTVIKHKRGSGAPDAADLSEGELALDFTNNAIYTKNASGTV |
| Ga0115546_10787791 | 3300009435 | Pelagic Marine | MATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYTENSGGTVL |
| Ga0115567_105427771 | 3300009508 | Pelagic Marine | MATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYTEDSGGTVLEL |
| Ga0098049_10686903 | 3300010149 | Marine | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTE |
| Ga0098049_10933173 | 3300010149 | Marine | MATTIVTKFGGDAPAASDIVRGELAVDTENGRLYT |
| Ga0129345_11945993 | 3300010297 | Freshwater To Marine Saline Gradient | MATTIKLKNGTGAPSAGALVVAEPALDLTNKRLYTEDSGGTVIEVGTN |
| Ga0136655_10576641 | 3300010316 | Freshwater To Marine Saline Gradient | MASTIKLKNGTGVPTAGDLVQGEPAFDLTNKRLYTENASGTVIE |
| Ga0136655_12151052 | 3300010316 | Freshwater To Marine Saline Gradient | MTTTIKLKNGSGVPTAGDLVQGEPAFDLTNKRLYTENASGT |
| Ga0136656_11532101 | 3300010318 | Freshwater To Marine Saline Gradient | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTENASGTVIEVGTNPTS |
| Ga0129324_100477461 | 3300010368 | Freshwater To Marine Saline Gradient | MATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTEDSGGT |
| Ga0129324_101754472 | 3300010368 | Freshwater To Marine Saline Gradient | MATTIKLKNGSGAPTAGDLVQGEPAFDLTNKRLYT |
| Ga0129324_102378963 | 3300010368 | Freshwater To Marine Saline Gradient | MATTIVTKNGSGAPTASDLVAGELAVDLTNKRLYTEDSGGTVLELGT |
| Ga0129324_102546002 | 3300010368 | Freshwater To Marine Saline Gradient | MTTTIKLKNGSGVPTAGDLVQGEPAFDLTNKRLYTENA |
| Ga0118731_1061916072 | 3300010392 | Marine | MTTIKLKNGSGAPAASDLVQGEPAFDLTNKRLYTEN |
| Ga0114922_116650441 | 3300011118 | Deep Subsurface | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGSVIE |
| Ga0129352_106297274 | 3300012528 | Aqueous | MAIKLKTGSGAPLPTDLIEGEPALDLTNKRLYSETGGVVFEVGTNPSEFTLA |
| Ga0129352_110137992 | 3300012528 | Aqueous | MATTIVTKNGSGAPTDSDLVAGELAVDLTNGRLYTTDLD |
| Ga0180120_100500353 | 3300017697 | Freshwater To Marine Saline Gradient | MTTIKLKNGSGAPAASDLVQGEPALDLTNKRLYTENASGTV |
| Ga0181390_10478621 | 3300017719 | Seawater | MTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTENASGTA |
| Ga0181421_11371661 | 3300017741 | Seawater | MATTIVTKSGSGAPAASDLVAGELAVDLTNKRLYTEDSSAAIIELG |
| Ga0181402_11467972 | 3300017743 | Seawater | MATTIVTKSGSGAPAASDLVAGELAVDLTNKRLYMEDGSAA |
| Ga0181389_10137754 | 3300017746 | Seawater | MATTIVTKYGSDAPAASDIVRGELAVDTENGRLYTENSSAAVI |
| Ga0181389_10700782 | 3300017746 | Seawater | MTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTENASGTVPPSP |
| Ga0181385_11459111 | 3300017764 | Seawater | MATTIKLKNGSGAPATSDLVQGEPAIDLTNRRLYTENAS |
| Ga0187217_10324561 | 3300017770 | Seawater | MTTIKLKNGSGAPTAGDLAQGEPALDLTNKRLYTEDSG |
| Ga0181430_12080091 | 3300017772 | Seawater | MATTIKLKNGSGAPAASSLLHAVPAFDLTNKRLYTEDANGAVIEVGSNPTALTLSNWTIQEVSNNLLFSYNG |
| Ga0181386_11118621 | 3300017773 | Seawater | MATTIVTKYGSDAPAASDIVRGELAVDTENGRLYTENAAGAVVE |
| Ga0181424_100244751 | 3300017786 | Seawater | MTTIKLKNGSGAPATSDLVQGEPALDLTNKRLYTENASGAVI |
| Ga0181565_107307391 | 3300017818 | Salt Marsh | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDS |
| Ga0181552_103110601 | 3300017824 | Salt Marsh | MASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSGGTVIEVGTN |
| Ga0181584_102324841 | 3300017949 | Salt Marsh | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGTVIEV |
| Ga0181577_100909371 | 3300017951 | Salt Marsh | MATTIVTKNGSGAPTASHLVAGELAVDLTNGRLYTE |
| Ga0181577_101274983 | 3300017951 | Salt Marsh | MPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTEDSG |
| Ga0181577_103831732 | 3300017951 | Salt Marsh | MATTIITKFGSGAPTADDVVRGELAVDTENKRLYTEDSGGSVV |
| Ga0181577_107775311 | 3300017951 | Salt Marsh | MATTIITKYGSGAPTTSDVVRGELAVDTENGRLYTLNSSNTV |
| Ga0181582_101920432 | 3300017958 | Salt Marsh | MATTIITKYGSGAPTTSDVVRGELAVDTENGRLYTLNSS |
| Ga0181589_106027912 | 3300017964 | Salt Marsh | MATTIITKYGSGAPTTSDVIRGELAVDTENGRLYTLNSSNAVVE |
| Ga0181590_111320842 | 3300017967 | Salt Marsh | MASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSGGTVIEVGTNPTEIQIDNINIDGN |
| Ga0181569_103411881 | 3300017986 | Salt Marsh | MPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTEDSGGSVI |
| Ga0181579_102305481 | 3300018039 | Salt Marsh | MATTIITKFGSGAPAASDVVRGELAVDTENGRLYTENIAGS |
| Ga0181601_102409491 | 3300018041 | Salt Marsh | MATTIVTKNGSGAPTASDLVAGELAVDLTNGRLYTTDLDSGGT |
| Ga0181553_104906662 | 3300018416 | Salt Marsh | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGTVI |
| Ga0181558_100686823 | 3300018417 | Salt Marsh | MATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTE |
| Ga0181558_106918541 | 3300018417 | Salt Marsh | MASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSGGTVIEV |
| Ga0181567_104404821 | 3300018418 | Salt Marsh | MATTIKLKNGSGAPSAASLVQGEPAFDLTNKRLYTEDSGGTVIEV |
| Ga0182058_14661552 | 3300019283 | Salt Marsh | MATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTED |
| Ga0194014_10533552 | 3300019732 | Sediment | MATTIVTKYGSDAPAASDLVRGELAVDTENGRLYTENAAGAV |
| Ga0193988_10687191 | 3300019740 | Sediment | MATTIITKNGSGAPTTDDLSTGELAIDLTNKRLYS |
| Ga0194002_10351111 | 3300019745 | Sediment | MATTIVTKNGSGAPTASDLVAGELAVDLTNGRLYTTDLDSGGTVLELGTNP |
| Ga0193956_10982301 | 3300019754 | Freshwater Microbial Mat | MATTIVTKNGSGAPTASDLVAGELAVDLTNGRLYTENSGGT |
| Ga0194024_10911091 | 3300019765 | Freshwater | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGTNP |
| Ga0181594_101801143 | 3300020054 | Salt Marsh | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGTNPSTI |
| Ga0181603_100907691 | 3300020174 | Salt Marsh | MATTIVTKNGTGAPTDSDLVAGELAVDLTNGRLYTTDLDSGGTV |
| Ga0206129_103271091 | 3300020182 | Seawater | MATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYTEDSGGTVLE |
| Ga0181605_104390271 | 3300020188 | Salt Marsh | MATTIVTKNGTGAPTDSDLVAGELAVDLTNGRLYTTDL |
| Ga0181597_100390144 | 3300020194 | Salt Marsh | MATTIITKNGSGAPLAGDLQVGELAIDLTNKKLYSKEGTTV |
| Ga0181570_104245042 | 3300020207 | Salt Marsh | MATTIKLKNGSGAPLASDLVQGEPALDLTNKRLYSEDSGGTV |
| Ga0181570_104341161 | 3300020207 | Salt Marsh | MPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTEDSGGSVIEIGLKPSGKV |
| Ga0213858_102362032 | 3300021356 | Seawater | MATTIITKFGSGAPTASDVVRGELAVDTENKRLYTEDSGG |
| Ga0213860_103997462 | 3300021368 | Seawater | MTTIKLKNGSGAPTAGDLVQGEPALDLTNKRLYTEDSGGTVI |
| Ga0213864_101408613 | 3300021379 | Seawater | MATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTEDSG |
| Ga0213864_105086992 | 3300021379 | Seawater | MATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTEDSGGTVIEVGT |
| Ga0213866_101753741 | 3300021425 | Seawater | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYT |
| Ga0222718_106182012 | 3300021958 | Estuarine Water | MATTLVTKNGSGAPASSDLISGELAVDLTNKRLYS |
| Ga0222719_105301421 | 3300021964 | Estuarine Water | MATTIITKNGSGAPLAGDLTAGELAVDLTNKRLYSKDSGGTVIELGTTPSS |
| Ga0222719_105574363 | 3300021964 | Estuarine Water | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGT |
| Ga0222719_107456541 | 3300021964 | Estuarine Water | MATTIKLKNGSGAPLASDLVQGEPAFDLTNKRLYTE |
| Ga0196895_10166813 | 3300022067 | Aqueous | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGTK |
| Ga0196895_10213672 | 3300022067 | Aqueous | MATTIVTKNGTGAPTASDLVAGELAVDLTNGRLYTTDLDSGGTVLELGTN |
| Ga0196895_10332401 | 3300022067 | Aqueous | MATTIKLKNGSGAPTAGDLVQGEPAFDLTNKRLYTEDSGGT |
| Ga0212021_11343041 | 3300022068 | Aqueous | MATTIKLKNGSGAPAASSLVQGEPAFDLTNKRLYTEDSGGTVIEIGSNPTALTLGNWT |
| Ga0196893_10171992 | 3300022159 | Aqueous | MTTIKLKNGSGAPTAGDLVQGEPALDLTNKRLYTENA |
| Ga0196893_10193142 | 3300022159 | Aqueous | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGT |
| Ga0212027_10348041 | 3300022168 | Aqueous | MATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYTEDSGGT |
| Ga0212027_10532571 | 3300022168 | Aqueous | MTTIKLKNGSGAPTAGDLVTAEPALDLTNKRLYTEDSGGTVIE |
| Ga0196903_10317112 | 3300022169 | Aqueous | MASTIKLKNGSGAPTTGDLVQGEPALDLTNKRLYTE |
| Ga0212031_10897032 | 3300022176 | Aqueous | MATTIITKNGSGAPLAGDLTAGELAVDLTNKRLYSKDSGGTV |
| Ga0196891_10805071 | 3300022183 | Aqueous | MATTIITKYGSGAPTADDLSVGELAVDLTNKRLYSKN |
| Ga0196905_10472741 | 3300022198 | Aqueous | MASTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTENASGV |
| Ga0196901_10442691 | 3300022200 | Aqueous | MATTIKLKNGTGVPLVGDLVQGEPAFDLTNKRLYTENAGGTVI |
| Ga0255781_103938161 | 3300022934 | Salt Marsh | VATTIKLKTGSGAPLNTDLVQGEPAIDLTNKRLYT |
| Ga0255743_101019023 | 3300023110 | Salt Marsh | MPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTEDSGG |
| Ga0255751_101328611 | 3300023116 | Salt Marsh | MATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTEDSGGTVIEVG |
| Ga0255772_103930413 | 3300023176 | Salt Marsh | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGTNPT |
| Ga0255759_101494371 | 3300023178 | Salt Marsh | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTED |
| Ga0255768_106228321 | 3300023180 | Salt Marsh | MATTIITKYGSGAPTADDLSIGELAVDLTNKRLYSKNSSSEVIELG |
| (restricted) Ga0233444_101159631 | 3300024264 | Seawater | MATTIITKNGSGAPAAGDLVQGELAVDLTNQTLYSKDSSGNVFKVG |
| (restricted) Ga0255049_105101992 | 3300024517 | Seawater | MATKIITKTGSGAPTTSDVDRGELAVDLTNKQLYTNDGXRT |
| Ga0208792_10900832 | 3300025085 | Marine | MTTIKLKNGSGAPTSGDLAQGEPALDLTNKRLYTEDSGGNVIE |
| Ga0208666_10418822 | 3300025102 | Marine | MTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTENASG |
| Ga0208303_10415714 | 3300025543 | Aqueous | MASTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYT |
| Ga0208303_10990392 | 3300025543 | Aqueous | MTTTIKLKNGTGVPTAGALVQGEPAFDLTNKRLYTENAG |
| Ga0208004_10075431 | 3300025630 | Aqueous | MASTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGNVI |
| Ga0208134_10653651 | 3300025652 | Aqueous | MTTIKLKNGSGAPTAGDLVQGEPALDLTNKRLYTEDSGGTVIEV |
| Ga0208162_10729523 | 3300025674 | Aqueous | MATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIE |
| Ga0208162_11740441 | 3300025674 | Aqueous | MASTIKLKNGSGAPLDSDLVAGEPALDLTNKRLYTEDSGGTVIE |
| Ga0208150_10444502 | 3300025751 | Aqueous | MASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSGGTVIEVGTNP |
| Ga0208150_12333241 | 3300025751 | Aqueous | MATTIVTKNGTGAPTDSDLVAGELAVDLTNGRLYTT |
| Ga0208899_10374704 | 3300025759 | Aqueous | MPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYT |
| Ga0208899_10814562 | 3300025759 | Aqueous | MTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTEDSGGTVIEVGT |
| Ga0208767_11105782 | 3300025769 | Aqueous | MATTIITKYGSGAPLASDLVRGELAVDTELGRLYTETSG |
| Ga0208427_11308022 | 3300025771 | Aqueous | MATTIKLKNGSGAPTAGDLVQGEPAFDLTNKRLYTE |
| Ga0208425_10099494 | 3300025803 | Aqueous | MATTIITKNGSGAPTTDDLSTGELAIDLTNKRLYSY |
| Ga0208545_11526981 | 3300025806 | Aqueous | MATTIVTKFGSDAPAASDIVRGELAVDTENGRLYTENAAGAVVEL |
| Ga0208785_11622842 | 3300025815 | Aqueous | MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGT |
| Ga0208917_11366902 | 3300025840 | Aqueous | MATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYT |
| Ga0208917_11672431 | 3300025840 | Aqueous | MASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSG |
| Ga0209534_100787821 | 3300025880 | Pelagic Marine | MATKIVTKSGSGAPTTDDLIAGELAVDLTNGRLYT |
| Ga0208544_101986282 | 3300025887 | Aqueous | MTTIKLKNGSGAPATSDLVQGEPALDLTNKRLYTENASGAII |
| Ga0208544_103596012 | 3300025887 | Aqueous | MATTIVTKYGSDAPATTDIVRGELAVDTENGRLYTENAA |
| Ga0208644_10300684 | 3300025889 | Aqueous | MASTIQLKRGSGAPTAGDLAVGEPALDLTNKRLYTEDTGG |
| Ga0208644_10304597 | 3300025889 | Aqueous | MATTIITKYGSGAPLASDLVRGELAVDTELGRLYTET |
| Ga0228644_10275712 | 3300026453 | Seawater | MSATTIITKNGSGAPAAGDLVQGELAVDLTNQTLYSKDSSGNVFK |
| Ga0208020_10107521 | 3300027159 | Estuarine | MATTIVTKSGSGAPAASDLVAGELAVDLTNGRLYTEDSGGT |
| Ga0209192_100787381 | 3300027752 | Marine | MASTIKLKRGSGEPGAGALVEGEPAFDLTNKRLYTENSGGTVLEIGTNPT |
| (restricted) Ga0255041_100812882 | 3300027837 | Seawater | MTTIITKNGSGAPTAGQLSEGELAVDLTNKELYTKSGSTVIKIGGTGG |
| Ga0209536_1006216311 | 3300027917 | Marine Sediment | MPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTDDGSSVIEIGLNPS |
| Ga0233450_103208341 | 3300028115 | Salt Marsh | MATTIKLKNGSGAPLASDLVQGEPAFDLTNKRLYTEDS |
| Ga0256368_10234532 | 3300028125 | Sea-Ice Brine | MATKIVTKSGSGAPATTDLVAGELAVDLTNKRLYTENGSAAIIV |
| Ga0307488_103080031 | 3300031519 | Sackhole Brine | MATKIVTKSGSGAPATTDLVAGELAVDLTNKRLYTENGSAA |
| Ga0307380_104861311 | 3300031539 | Soil | MTTIKLKNGSGAPDAADLVQGEVALDLTNKRIYSENASGTVIE |
| Ga0316201_102319922 | 3300032136 | Worm Burrow | MATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTEDSGGTVIEVGTNP |
| Ga0314858_100063_1_135 | 3300033742 | Sea-Ice Brine | MATTIVTKSGSGAPTASDLVAGELAVDLTNGRLYTEDSGGTVLEL |
| ⦗Top⦘ |