| Basic Information | |
|---|---|
| Family ID | F037034 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNF |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 67.27 % |
| % of genes near scaffold ends (potentially truncated) | 98.21 % |
| % of genes from short scaffolds (< 2000 bps) | 97.62 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.405 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (38.691 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.976 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (74.405 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.40 % |
| All Organisms | root | All Organisms | 0.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 38.69% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 35.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 11.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.17% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.38% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 2.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 1.19% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300020031 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025517 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-5-D (SPAdes) | Engineered | Open in IMG/M |
| 3300025529 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-4-D (SPAdes) | Engineered | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028147 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028155 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028463 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070690_1010412201 | 3300005330 | Switchgrass Rhizosphere | MVPNAPKRYETNQNISLGSNGVDRVRSLRKILMRVRGTKFCTS |
| Ga0070668_1017597311 | 3300005347 | Switchgrass Rhizosphere | MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNF |
| Ga0070706_1020233721 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVPNAPKQYETNQNISLGSNGVDRVRSLRKILMRLRGTKFCTSSD |
| Ga0068859_1010569292 | 3300005617 | Switchgrass Rhizosphere | MVPNAPKWYEMHQNVSLGSNGVDRVRSLRKIPMRLHG |
| Ga0068859_1012487211 | 3300005617 | Switchgrass Rhizosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLQKIPMRLRGINFCT |
| Ga0068859_1018720022 | 3300005617 | Switchgrass Rhizosphere | MVANAPKRYGMHQNMSLGSNGVDRVGSLRKILTRL |
| Ga0068864_1005635231 | 3300005618 | Switchgrass Rhizosphere | MVPNAPELYETHQNVSLGSNGVDRVRSLRKILTRLRGTNFC |
| Ga0068863_1013712221 | 3300005841 | Switchgrass Rhizosphere | MVPNAPKRYETHQNISLGSNGVDRVRSLRKILMRLRGTKF |
| Ga0068863_1025583651 | 3300005841 | Switchgrass Rhizosphere | MVPNAPKWYEMHLNISLGSNGLDRVRSLRKIPTRLRGTN |
| Ga0068858_1022136652 | 3300005842 | Switchgrass Rhizosphere | VSCSYETIPNAPKHHATHQNMSLGSNGVDWVCSLQKIPM* |
| Ga0068860_1008092062 | 3300005843 | Switchgrass Rhizosphere | VVQNAPKWYETQQNMSLVSNGVDLVRSLRKILTRLRGTNFCTYS |
| Ga0068860_1014076741 | 3300005843 | Switchgrass Rhizosphere | MVPDAPKRYETNQNISLGSNGVDRVRSLRKILMRLRGTKFC |
| Ga0068860_1018967531 | 3300005843 | Switchgrass Rhizosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTN |
| Ga0068860_1022601251 | 3300005843 | Switchgrass Rhizosphere | MIPNAPKHYEPDQNMGLGSNGVDRVRSL*KIPTRLRGTNF |
| Ga0068860_1024250401 | 3300005843 | Switchgrass Rhizosphere | MISNETKHYEPDQNMGLGSNGVDRVRSL*KIPTRLRGTNF |
| Ga0068862_1020391651 | 3300005844 | Switchgrass Rhizosphere | MVPNALKRKEKHQNKSLGSNGVDREHSLRKILARHRGMNFCINC |
| Ga0105250_104532621 | 3300009092 | Switchgrass Rhizosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLR |
| Ga0105247_114476801 | 3300009101 | Switchgrass Rhizosphere | MVPNARKWYEMHQNMSLGSNAVDQVHLLRIILICLHGINF |
| Ga0105135_1238841 | 3300009980 | Switchgrass Associated | NAPKHYKTHQFMSLASNGVDRVRSLQKIPMGLHGTKFFTS* |
| Ga0105132_1243151 | 3300009990 | Switchgrass Associated | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCTSSA |
| Ga0105120_10034521 | 3300009992 | Switchgrass Associated | MVPNAHKRKETHQNMSLGSNGVDRERSLRKIMTRLRGMN |
| Ga0105120_10316302 | 3300009992 | Switchgrass Associated | MVPNAPKWKETHQNMSLGSNGVDREHTLRKISKQLHGTIFW |
| Ga0134125_121563551 | 3300010371 | Terrestrial Soil | MVPNAPKWYEAHQNMSLGSNGVDRMLSLRKIPMRL |
| Ga0134127_126569682 | 3300010399 | Terrestrial Soil | MVPNAPKWYETHENMSLGSNGVDRVHWLRKIPMQL |
| Ga0134127_128933301 | 3300010399 | Terrestrial Soil | MDAPKWYEMHQNISLGPNGVDRVRSLRKIPTQLRDMNFCT |
| Ga0134122_124956901 | 3300010400 | Terrestrial Soil | MVANAPKWYEMHQNMSLGSNGVHRVGLLRKILTRLRGTNFCT |
| Ga0153798_102623381 | 3300012949 | Switchgrass Degrading | MVPNAPKWYETHQNMSLWSNGVDRVLSFRKIPMRLRGT |
| Ga0157379_118877921 | 3300014968 | Switchgrass Rhizosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCT |
| Ga0182183_10095212 | 3300015270 | Switchgrass Phyllosphere | MVPNASKWYETHQKVSLGSNGVDRARSLRKILTRLRG |
| Ga0182105_10862451 | 3300015290 | Switchgrass Phyllosphere | MVPNAPKWNEMDQNMSLGSNSVDRECLLRKFLTRHRGTNFCIN |
| Ga0182184_10809321 | 3300015301 | Switchgrass Phyllosphere | MVPNARKRYESRQNMSLGSNGVDRVRSLRKIPMRLRGTNFCTSS |
| Ga0182180_10869751 | 3300015306 | Switchgrass Phyllosphere | MVPNAPKRYETNKNISLGSNGVDRVRSLRKILMRVRGTKFCTSSDRFPPS |
| Ga0182180_10929471 | 3300015306 | Switchgrass Phyllosphere | MVPNAPKWYETHQNFSLGSNGVDRVLSFRKIPMQLRGTNFCTRSAR |
| Ga0182162_11104841 | 3300015310 | Switchgrass Phyllosphere | MVPNATKWYKTQQNMSLGSNGVDRVRLLRKIPMRLR |
| Ga0182182_10181021 | 3300015311 | Switchgrass Phyllosphere | MVAKAPKWYERHQNMSLGSNGVDRVGSLRKILTRLRG |
| Ga0182182_10548491 | 3300015311 | Switchgrass Phyllosphere | MVPNAPKRYETHQNISLGSNGVDRVRSL*KIPMRLRGTN |
| Ga0182168_10409481 | 3300015312 | Switchgrass Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLCGTNFCIS |
| Ga0182168_10941441 | 3300015312 | Switchgrass Phyllosphere | MVENAPKWYEIHQNMSLGSNGVDRVRSLRKILTRLRDTN |
| Ga0182168_11029611 | 3300015312 | Switchgrass Phyllosphere | MVPNAHKWYETHQNISLGSNGVDRARSLRKIPTRLRGT |
| Ga0182164_11098931 | 3300015313 | Switchgrass Phyllosphere | MVANAPKWYEMHQNMSLGSNGVHRVGSLRKILTRLR |
| Ga0182120_10305601 | 3300015315 | Switchgrass Phyllosphere | MVANAPKWKETHQNMFLGSNSVDQEHSLRKIPTRLRGT |
| Ga0182120_11225001 | 3300015315 | Switchgrass Phyllosphere | MVANAPKRYEMQQNMSLGSNGVDRVLSWRKIPMRLRGTNFC |
| Ga0182121_11127141 | 3300015316 | Switchgrass Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNF |
| Ga0182136_10597801 | 3300015317 | Switchgrass Phyllosphere | MVPNAPKWYETHQNMSLWSNGVDRVLSFRKIPMRLR |
| Ga0182136_10689951 | 3300015317 | Switchgrass Phyllosphere | PKWHETHQNISLVLNGVDLVRSLRKIAMRLRGTNF* |
| Ga0182148_10324301 | 3300015325 | Switchgrass Phyllosphere | MDPNAPKLYEMHQNISLGPNGVDRVRSLRKIPTQLR |
| Ga0182148_11128621 | 3300015325 | Switchgrass Phyllosphere | MVPNAPKQYETNQNIGLGANGVDRVRSLRIIPKRLRGTNFCTSSARFASSF |
| Ga0182148_11306851 | 3300015325 | Switchgrass Phyllosphere | MVANAPKWYEMHQNMSLGSNGVDRVLSLRKISMRLR |
| Ga0182166_10263721 | 3300015326 | Switchgrass Phyllosphere | MVANAPKRYEIHQNMSLGSNGVDRVGLLRKILTQLRGTNF |
| Ga0182153_10629401 | 3300015328 | Switchgrass Phyllosphere | MVPNAPKWYETHQNMSFGSNGMDRMISLRKIPMRLHGTNFY |
| Ga0182135_10251441 | 3300015329 | Switchgrass Phyllosphere | MVLDALKWYEMHQNISLGPNGVDRVHSLRKIPTRLRG |
| Ga0182135_11308861 | 3300015329 | Switchgrass Phyllosphere | MVMDAPKWYEMHQNISLGPNGVDRVRSLRKIPTQL |
| Ga0182131_11552031 | 3300015331 | Switchgrass Phyllosphere | MVPNAPKWYEMHQNVSLGSNGVDRVRSLRKIPTRLCGTN |
| Ga0182147_10811561 | 3300015333 | Switchgrass Phyllosphere | MVPNAPKWKETKQNTSLGSNGVDRERSL*KILARYRGMNFCIN |
| Ga0182147_10945471 | 3300015333 | Switchgrass Phyllosphere | MVPNSLKQYQMHQNMSLGSNGMDRVRSLRKIPTQLCGTNF |
| Ga0182132_11049861 | 3300015334 | Switchgrass Phyllosphere | MVPNAPKHYKTQQNMSLGSNGVDRVRSLRKISRLF |
| Ga0182116_10949481 | 3300015335 | Switchgrass Phyllosphere | MIPNAPKHYEPDQNMGLGSNGVDRVRSL*KIPTRLRGTNFCINCTS |
| Ga0182116_11081051 | 3300015335 | Switchgrass Phyllosphere | MVPNAPKRYETNQNISLGSNGVDRVRSLRKILMRVRGTKFCTSSDRFPPSFLR |
| Ga0182116_11613491 | 3300015335 | Switchgrass Phyllosphere | MISNETKHYEPDQNMGLGSNGVDRVRSL*KIPTRLRGTNFCINCTS |
| Ga0182150_10334361 | 3300015336 | Switchgrass Phyllosphere | MVPNAPKWKETHQNMSLDSNGVDRERLLRKFLTTHRGTNF |
| Ga0182151_10450551 | 3300015337 | Switchgrass Phyllosphere | MVQNAPKWYETQQNMSLGSNGVDRVRSLRKIPTRLRGTNF |
| Ga0182149_11363141 | 3300015339 | Switchgrass Phyllosphere | MVPNAHKLYEMHQNVSLGSNGVDRVRSLRKIPMRLRFTNFCTS |
| Ga0182149_11587371 | 3300015339 | Switchgrass Phyllosphere | MVPNAPKRYEMHQNISLGSNGVDQVRSLRKIPMQLRGANFCTSSARFAPS |
| Ga0182133_11741301 | 3300015340 | Switchgrass Phyllosphere | MLPNSTKRTENVSLGSNGVDRVRSLRKIPTRLRGTNF |
| Ga0182115_10913672 | 3300015348 | Switchgrass Phyllosphere | SNETIQNAPKHYKMNMSLRSNGLDRVRSLRKILMRLYGTN* |
| Ga0182115_11530101 | 3300015348 | Switchgrass Phyllosphere | MVLYAPEWYETHQNVSLGSNGVDRVRSLPKIPTQLRGTNFCTSSARFPS |
| Ga0182115_12464991 | 3300015348 | Switchgrass Phyllosphere | MVPNALKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCT |
| Ga0182185_12298861 | 3300015349 | Switchgrass Phyllosphere | MILNAPKLYETYQNMSLGSNGVDRVRSLRKIPK*LRDTN |
| Ga0182163_11462391 | 3300015350 | Switchgrass Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDRVRSMRNDSTRLRRTNFCTSSERF |
| Ga0182163_11560601 | 3300015350 | Switchgrass Phyllosphere | VLDALKWYEMHQNISLGPNGVDRVRSLRKIPTRLRGTN |
| Ga0182169_12527381 | 3300015352 | Switchgrass Phyllosphere | MVPNAPKLYEMHQNNSLRSNGVDRVRFLRKIPTQLCGT |
| Ga0182169_13157271 | 3300015352 | Switchgrass Phyllosphere | MVPNAPKQYETNQNISLASNGVDRVRSLRKILMRLRGTKFCTSSDRFAPS |
| Ga0182179_12816911 | 3300015353 | Switchgrass Phyllosphere | MVPNAPKHYKTQQNMSLGSNGVDGVRLLQKIPTQLH |
| Ga0182179_12835591 | 3300015353 | Switchgrass Phyllosphere | MVPNAPKRYETNQNISLGSNGVDRVRSLRKILMRVRGTKFCTSSDRFPPSFL |
| Ga0182179_12838031 | 3300015353 | Switchgrass Phyllosphere | MVANAQKRYKMHQNMSLGSNGVDRVGSLRKILTQLRG |
| Ga0182179_13265131 | 3300015353 | Switchgrass Phyllosphere | MVPNMPKWNEMHQNISLGSNGVDRVRSLRKILMQLRGSNICT |
| Ga0182167_11951461 | 3300015354 | Switchgrass Phyllosphere | MVPNAPKRYETNQNISLGSNGVDRVRLLEKILMRVRGTKF |
| Ga0182167_12313921 | 3300015354 | Switchgrass Phyllosphere | LNAPKWHETHQNISLVLNGVDLVRSLRKIAMRLRGTNF* |
| Ga0182199_11378911 | 3300017412 | Switchgrass Phyllosphere | MVPNGPKWKEMHLNMSLGSSGVDRERSLRKILARYRGMNFCINCTSL |
| Ga0182199_12025361 | 3300017412 | Switchgrass Phyllosphere | MVPNAPKRYKMHQNVSFRSNGVDRVRSLRKIPKRLRGT |
| Ga0182195_12022221 | 3300017414 | Switchgrass Phyllosphere | MVPNASKWYEMNQNVSLGTNGVDRVRLLRKILTQLRGTNFCTSS |
| Ga0182200_10811911 | 3300017439 | Switchgrass Phyllosphere | MVLKAPKYYETHQNVSLGSNGLDRVRSLRKIPTRLRATNF |
| Ga0182200_11388271 | 3300017439 | Switchgrass Phyllosphere | MVSNAPKNYETHQNMSLGSNGVNRVRSFXKIPARLRAQNFALIAPVQ |
| Ga0182214_11493051 | 3300017440 | Switchgrass Phyllosphere | MFPNAPKRKEKHQNMSLGSNGVDREHSLRKIITRLRGTN |
| Ga0182198_10997661 | 3300017445 | Switchgrass Phyllosphere | MVANAPKRYETHQNMSLGSNGVDRVRSLRNILMRLRGTKF |
| Ga0182210_11612551 | 3300017692 | Switchgrass Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNICTSSAR |
| Ga0163161_107418541 | 3300017792 | Switchgrass Rhizosphere | MVPNAPKRYETNQNISLGSNGVDRVCSLRKILMRVRGTKF |
| Ga0182119_1055481 | 3300020031 | Switchgrass Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLQKIPMRLRGQ |
| Ga0182118_1029461 | 3300020223 | Switchgrass Phyllosphere | MVANAPKWYEMHQNMSLGSNGVHRVGLLRKILTQLRGTNFC |
| Ga0182118_1091451 | 3300020223 | Switchgrass Phyllosphere | MHAPNWYETHQNVSLGLNGVDQVPSLRKILTQLRGTNFCTR |
| Ga0182118_1101041 | 3300020223 | Switchgrass Phyllosphere | MVPNAPKWYKTHQNMSLGSNGVDRVLSLRKIPMRLRGTNFC |
| Ga0207869_10431901 | 3300025517 | Ionic Liquid And High Solid Enriched | MVPNAAKWYEMHQNVSLGSNRVDRVRSLRKIRTRLRG |
| Ga0207865_1220311 | 3300025529 | Ionic Liquid And High Solid Enriched | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCIT |
| Ga0207680_110963271 | 3300025903 | Switchgrass Rhizosphere | MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNFLHYLGPF |
| Ga0207699_108844961 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MVPNAPKWYETNQNMSLGSNGMDRVLSLRKIPMRLRGINF |
| Ga0207681_116094641 | 3300025923 | Switchgrass Rhizosphere | MVAKTPKRYETHKNMSLDTNGVDRVGSTRKILTRLRG |
| Ga0207668_102807481 | 3300025972 | Switchgrass Rhizosphere | MVANAPKWYEMHENMSLGSNGVDRVGSLRKILMRLRGT |
| Ga0207668_110966581 | 3300025972 | Switchgrass Rhizosphere | MVPNAPKWKETHQNMSLDSNGVDRERLLRKFLTRHCGTNF |
| Ga0207703_104597661 | 3300026035 | Switchgrass Rhizosphere | MVPNAPKRYETNQNISLGSNGVDRVCSLRKILMRVRGTKFCTSSDR |
| Ga0207703_111852681 | 3300026035 | Switchgrass Rhizosphere | MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNFLHYLGPFCTEFCKATKH |
| Ga0207703_120447501 | 3300026035 | Switchgrass Rhizosphere | MVPNAPKWYGTHQNMSLGSNGVDRVRSLRNDSTQL |
| Ga0207676_119304201 | 3300026095 | Switchgrass Rhizosphere | MVLDAPKWYKMHQNVSLGTNGVDRVRSLRKILTRLRGT |
| Ga0268322_10078791 | 3300028049 | Phyllosphere | VLDALKWYEMHQNVSLGPNGVDQVSSLRQILPQLRGTNF |
| Ga0268328_10095911 | 3300028050 | Phyllosphere | MVPNAPKLYGTHQNVSLGFNWVDLVRSLRKITTRLRGM |
| Ga0268328_10276781 | 3300028050 | Phyllosphere | MIPNAPKHYETHQNMSLGSNGVDRVRSLRKITTRLRGT |
| Ga0268328_10527791 | 3300028050 | Phyllosphere | MVQNAPKLYETHQNMSLGSNGVDRVRWLRKIPTRLRGM |
| Ga0268328_10664461 | 3300028050 | Phyllosphere | MVANEPKQYETHQNMSLGSNGGDRVRLSQILTRLRGTNFCTSS |
| Ga0268344_10232611 | 3300028051 | Phyllosphere | MVLDAPKLYEMHQNVSLGTNGVDRVRSLRKILTRLRGTN |
| Ga0268344_10264742 | 3300028051 | Phyllosphere | MVANAPKWYEIHQNMSLGTNRMDRVGLLRKILTQFRVTNF |
| Ga0268346_10088811 | 3300028053 | Phyllosphere | MVLNALKCYETHQNVSLGSNGVDRAHSLRKIPTRLRGTNFC |
| Ga0268346_10222681 | 3300028053 | Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCTSS |
| Ga0268306_10335601 | 3300028054 | Phyllosphere | MVANAPKWYEMHQNMSLGSNGVDRVGLLRKILTRLRGTNF |
| Ga0268338_10287431 | 3300028055 | Phyllosphere | MVPNAPKRYETNKNISLGSNGVDRVRSLRKILMRVRGTKFCTSSDR |
| Ga0268330_10254021 | 3300028056 | Phyllosphere | MVPNAPKWYETHQNMSLGSNWVDRVHSMRNDSTRLRRTNF |
| Ga0268332_10002351 | 3300028058 | Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDLVLSLQKIPMRLRGTNFCI |
| Ga0268332_10083281 | 3300028058 | Phyllosphere | MVENAPKWYEIHQNMSLGSNGVDRVRSLRKILTRLRDTNFCTS |
| Ga0268314_10423961 | 3300028061 | Phyllosphere | MVPNAPKWKETHQNMSLDSNGVDRERLLRKFLTTHRGT |
| Ga0268314_10501651 | 3300028061 | Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDRMLSLRKIPMRLRGSNFCI |
| Ga0268342_10047882 | 3300028062 | Phyllosphere | MIPNAPKHYKTDQNKGLGSNGVDRVRSLXKIPTRLC |
| Ga0268342_10048302 | 3300028062 | Phyllosphere | MVAKQPKRYEMHENISLGTNGVDRVGSLRKILTRLHGT |
| Ga0268350_10559421 | 3300028063 | Phyllosphere | MVPNAPKRYETNQNISLRSNGVDRVRSLGKILMRVRGTKF |
| Ga0268340_10411491 | 3300028064 | Phyllosphere | MVQNAPERKEMHQNMSLGSNGVDRERLLQKNLTRHRGRNFSINCT |
| Ga0268340_10628811 | 3300028064 | Phyllosphere | MVQNAPKWYKTQQNMSLGSNGVDRVRSLRKIPRRLRGTNFCT |
| Ga0268334_10020121 | 3300028140 | Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLQKIPMRLRGINFCTSS |
| Ga0268334_10083481 | 3300028140 | Phyllosphere | MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNFLH |
| Ga0268347_10059821 | 3300028142 | Phyllosphere | EGNIMVPNAPKWYETHQNMSLGSNGVDRVLSLLKIPM |
| Ga0268347_10098631 | 3300028142 | Phyllosphere | MIPNAPKHYEPDQNMGLGSNGVDRVRSLXKIPTRL |
| Ga0268347_10176121 | 3300028142 | Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGPNF |
| Ga0268347_10220531 | 3300028142 | Phyllosphere | MVANAPKWYEMHQNMSLGSNGLDRVAPLRKILMRLRGTN |
| Ga0268347_10332251 | 3300028142 | Phyllosphere | MVANAPKRYEMHQNMSLGSNGVDRVGSLRKILTQLRGTNF |
| Ga0268347_10342251 | 3300028142 | Phyllosphere | MHPKRYETHQNISLGSNRVDRVRSLRKILMRVRGTKFY |
| Ga0268345_10178101 | 3300028144 | Phyllosphere | VLDALKWYEIHQNISLGPNGVDRVRSLRKIPTRLRGTNFCTSSAGF |
| Ga0268345_10232671 | 3300028144 | Phyllosphere | MVPNARKRYETHQYMSLGSNGVDRVRSLPKIPMRLRGTNFCT |
| Ga0268303_1062281 | 3300028147 | Phyllosphere | MVQNAPKWYETQQNMGLGSNGVDWVRSLRKIPTRLR |
| Ga0268343_10071451 | 3300028150 | Phyllosphere | MVANAPKRYEIHQNMSLGSNGVDRVGLLRKILTQLRGTNFC |
| Ga0268308_10005511 | 3300028151 | Phyllosphere | MVPNALKQYETHQNMSLGSNVMDRVPSLRKIPMRLH |
| Ga0268308_10146471 | 3300028151 | Phyllosphere | MIPNAPKRYETNQNISLGSNGVDRVRSLRKNLMRLRGTK |
| Ga0268308_10237081 | 3300028151 | Phyllosphere | MVKNAPKHYETHQNISLGSNGVDRVRLSXKTPTRLRRMNFYTNSEHF |
| Ga0268320_10254121 | 3300028153 | Phyllosphere | MVPNAPKHYKTQQNMSLGSNGVDRVRPLQNIPTQLCR |
| Ga0268341_10088391 | 3300028154 | Phyllosphere | MVPNAPKWYETHQNMSLWSNGVDRVLSFRKIPMRLRGTN |
| Ga0268341_10227631 | 3300028154 | Phyllosphere | MVRTCGLIAPKYYEALQNMSLGSNGVVRFCSLRKNLMRLRGT |
| Ga0268341_10230431 | 3300028154 | Phyllosphere | MVPNAPKRYETNQNISLGSNGVDRVRSLRKILMRLRGTKFCTSSDRFAP |
| Ga0268349_10292111 | 3300028155 | Phyllosphere | MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNFCTSS |
| Ga0268312_10150581 | 3300028248 | Phyllosphere | MVQNAPKWYETQQNMGLGSNGVDRVRSLRNNLMQLR |
| Ga0268324_10112321 | 3300028251 | Phyllosphere | MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRL |
| Ga0268324_10222841 | 3300028251 | Phyllosphere | MVPNAPKRYEMHQNISLGSNGLDRVRSLRNILMRLRG |
| Ga0268304_10063831 | 3300028256 | Phyllosphere | MVAKAPKWYEMHQNMSLGSNGVDRVGSLRKILTRLRG |
| Ga0268310_10509271 | 3300028262 | Phyllosphere | MVPNAPKWHETHQNMSLGSNGVDRVLSLQKIPKRL |
| Ga0268266_107477161 | 3300028379 | Switchgrass Rhizosphere | MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCI |
| Ga0268266_112165431 | 3300028379 | Switchgrass Rhizosphere | MVPNAPKWKETHQNMSLDSNGVDRERSLQKFLTRHRGTNFCI |
| Ga0268264_116936891 | 3300028381 | Switchgrass Rhizosphere | MISNETKHYEPDQNMGLGSNGVDRVRSLXKIPTRLRGTNFCINC |
| Ga0268264_119906001 | 3300028381 | Switchgrass Rhizosphere | MVANAPKWYEMHQNMSLGSNGVDRVGLLRKILTRLRGTNFC |
| Ga0268325_1034261 | 3300028463 | Phyllosphere | DNQTIPNAPKWYETHQNMSLGSNEVDRVLSLRKIPM |
| Ga0268321_1103982 | 3300028466 | Phyllosphere | MVPNAPKWKETHQNMSLDSNGVDRERLLRKFLTTH |
| Ga0268317_10034311 | 3300028468 | Phyllosphere | MVPNAPKRYETHQNISLGSNGVDRLLSLQKIPTRLRGTNFC |
| Ga0268317_10123841 | 3300028468 | Phyllosphere | MVLNAPKWYEMLQNVSLGSNGVDRVHSLRKILMRVRGTNFCTS |
| Ga0268337_10126301 | 3300028469 | Phyllosphere | TLLNAPKHYETHQNMTLGSNGVDRVRSLPKIMMRVDGTSF |
| Ga0268307_10050121 | 3300028470 | Phyllosphere | MVPNAPKWFETRQNMSLGSNGVDRVCLLRKIPMQLRG |
| Ga0268315_10049692 | 3300028472 | Phyllosphere | MVPNAPKWYETHQNMSLGSNGVDLVLSLQRIPMRLRGTNFCI |
| Ga0268327_10125941 | 3300028475 | Phyllosphere | MVPNAPKRYETNQNISLGSNGVDRVRSLRKNLMRVRGTKLCTSSNRF |
| Ga0268329_10074031 | 3300028476 | Phyllosphere | MVANAPKWYGMHQNMSLGSNGVDRVGSLRKILTRLRG |
| Ga0268309_10123491 | 3300028477 | Phyllosphere | MVPNAPKQKETHQNLSLGSNGVDRERSLRKIQTIHRGTS |
| Ga0268313_10184881 | 3300028523 | Phyllosphere | MVPNAPKWYETQQNMSLGSNGVDRVLSLRKIPMRLRGTNF |
| Ga0268335_10046781 | 3300028527 | Phyllosphere | MVANAPKWYEMHQNMSLGSNGVHRVGLLRKILTLL |
| Ga0268311_10077842 | 3300028529 | Phyllosphere | MVTNAPKWYEMHQNMSLGSNGVDRVGSLRKILTRLRG |
| Ga0214493_11154431 | 3300032465 | Switchgrass Phyllosphere | MKAPKLYETHQNISLGSNELDRVRSLRKILTRLRGTNFCTRSAR |
| Ga0214493_11183541 | 3300032465 | Switchgrass Phyllosphere | MVPNAPKWYEAHQNMSLGSNGVDRMLSLRKIPMRLRGTNF |
| Ga0214495_10971131 | 3300032490 | Switchgrass Phyllosphere | MVPNARKLYETPQNISLGSNGVDRVRSLRKIPTRLRGTKFC |
| ⦗Top⦘ |