 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F036627 |
| Family Type | Metagenome |
| Number of Sequences | 169 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKSDTEIIETSNQNNQMQDIESFKTNPNSLKLDHRKLR |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.37 % |
| % of genes near scaffold ends (potentially truncated) | 23.08 % |
| % of genes from short scaffolds (< 2000 bps) | 98.22 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.817 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (18.343 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.686 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF14214 | Helitron_like_N | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.82 % |
| All Organisms | root | All Organisms | 1.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.28% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 4.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.78% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.18% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.18% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.59% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.59% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002118 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 | Environmental | Open in IMG/M |
| 3300002530 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_3 | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011399 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2 | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012161 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300024037 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-Q75 | Environmental | Open in IMG/M |
| 3300025119 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026915 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN106 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26622_10051941 | 3300002118 | Soil | MKSDTEIIETSNQNNQMQDIESFKTNPNSLKLDRRKLR* |
| C687J35503_101218041 | 3300002530 | Soil | LNEIKSDTEIVETSNQNNQMQDIKSFKTNPNSSKLDYRKLR* |
| JGI25387J43893_10374871 | 3300002915 | Grasslands Soil | LNEGKSDTEIIETSNQNRQMQDIESFKTNPDSLKLDHRKLR* |
| Ga0066680_106990742 | 3300005174 | Soil | MKIKSDTEIIETSNQNKKMQNIESFKTNPNSLKLDHRKLR* |
| Ga0066684_102383102 | 3300005179 | Soil | LNEDESDTEIVGTSNQNDQMQVIESFKTNPNSSKLDYRKLR* |
| Ga0066671_100688303 | 3300005184 | Soil | MKIKSVAEIIETSNQNNLFQDIESIKTNLNSLKLDHRMLR* |
| Ga0066671_108509111 | 3300005184 | Soil | IIETLNEGKSDTEIIETSNQNSQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0066676_107110031 | 3300005186 | Soil | LNKDESDTEIVGTSNQNDQMQVIESFKTNPNSSKLDYRKLR* |
| Ga0066676_108887132 | 3300005186 | Soil | MKVKRGAEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0070689_1012937651 | 3300005340 | Switchgrass Rhizosphere | LNEGKSDTEIIETSNQNSQMQDIESIKINPNSLKLDHRKLR* |
| Ga0070691_109999381 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LNEGESDTEIIETSNQNSQMQNIDSFKTNPNSLKLDHRKL |
| Ga0070659_1020051442 | 3300005366 | Corn Rhizosphere | LNEGESDTEIIETSNQNSQMQDIESIKINPNSLKLDHRKLR* |
| Ga0066682_107574012 | 3300005450 | Soil | LNEGKSDTEIIETSNQNSQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0066687_108962281 | 3300005454 | Soil | LNEGKSDTEIIETSNQNRQMQDIESFKTNPNSLKLDYRKLR* |
| Ga0070706_1002647801 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LNEGESDTEIIETSNQNSQMQDSESFKTNPNSLKLDHRKLR* |
| Ga0070706_1007003281 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LNEGKSDTEIIETSNQNKQMQDIESIKINPNSLKLDHRKLR* |
| Ga0070698_1017698771 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LNEVESDTEIVETSNQNNQMQDIESFKTNPTSSKLDHRKLR* |
| Ga0070699_1014075482 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LNENESDTEFVETSDHNNQMQDVKSIKTNPNSLKLDHRKLR* |
| Ga0066701_104077981 | 3300005552 | Soil | LNKGKSDTEIIETSNQNSQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0066661_106032782 | 3300005554 | Soil | VKHDTEIIETSNQNNQMQVIESIKINPNSLTLDHRKLR* |
| Ga0066692_110277701 | 3300005555 | Soil | VKCGTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0066707_109045462 | 3300005556 | Soil | VKRGTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0066698_108516642 | 3300005558 | Soil | VKHGTEIIETSNQNNQIKVIESIKINPNSLKLDHRKLR* |
| Ga0066670_103502203 | 3300005560 | Soil | MNIKSDTEIIETSNQNKKMQNIKSFKTNPNSLKLDHRKLR* |
| Ga0066702_105743443 | 3300005575 | Soil | MKIKSDTEIIETSNQNKKMQNIKSFKTNPNSLKLDHRKLR* |
| Ga0066708_101495171 | 3300005576 | Soil | VKHGTEIIETSNQNNQMQVIKSFKTNPNSLKLDHRKLR* |
| Ga0066706_114625572 | 3300005598 | Soil | LNEDERDTEIVETSNQNDQMQDIESFKTNPNSSKLDHRKLR* |
| Ga0068863_1019170831 | 3300005841 | Switchgrass Rhizosphere | VKHGTEIIETSNQNNQMQVIESFKINPNSLKLDHRKLR* |
| Ga0068860_1027577441 | 3300005843 | Switchgrass Rhizosphere | MKVKHGTEIIETSNQNNQMQDIESIRINPNSLKLDHRKLR* |
| Ga0066651_104421401 | 3300006031 | Soil | MKISDTEVIENSNQNNQIQDTESFKINPNSLKLDHRKLR* |
| Ga0066652_1011604833 | 3300006046 | Soil | MKVKRGAEIIETSNQNNQMQVIESIKINPNSLKLDH |
| Ga0066652_1016513851 | 3300006046 | Soil | LNEGKSDTEIIETSNQNRQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0066652_1018715392 | 3300006046 | Soil | VESDTEIIETSNQNSQMQDIESFKTNPDSLKLDYRKLR* |
| Ga0066658_102619382 | 3300006794 | Soil | MNEDESDTEIVGTSNQNDQMQVIESFKTNPNSSKLDYRKLR* |
| Ga0066658_103292621 | 3300006794 | Soil | VKLGTEIIETSNQNNQMQDIESIKINPNSLKLDHRKLR* |
| Ga0066658_103323182 | 3300006794 | Soil | NTEIIETSNQNYQMQDIESFKTNSNSSKLDHRKLR* |
| Ga0066658_104471803 | 3300006794 | Soil | KSDTEIIETSNQNNKMQNTESFKTNPNLLKLGHRKLS* |
| Ga0066658_104910612 | 3300006794 | Soil | VKHDTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0075434_1022574161 | 3300006871 | Populus Rhizosphere | VKHGTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0079217_113227951 | 3300006876 | Agricultural Soil | LNEIKSDTEIIGTSNQSDQMQDIESFKTNPNSSKLDHRKLR* |
| Ga0075426_108940871 | 3300006903 | Populus Rhizosphere | DTEVIETSNQNNQMQDIESFKTNPNLLKLDHRKLR* |
| Ga0079216_104761541 | 3300006918 | Agricultural Soil | MKSDTEIIETSNQNDQMQDIKGFKTNPNSLKLDRKKLR* |
| Ga0079216_106055261 | 3300006918 | Agricultural Soil | KINFSYNRTLNEIKSDTEIVETSNQNNQMQDIKSYKTNPNSSKLDYRKLR* |
| Ga0079218_108504331 | 3300007004 | Agricultural Soil | INFSYNRTLNEIKSDTEIIGTSNQIDQMQDIESFKTNPNSSKLDHRKLR* |
| Ga0079218_120593071 | 3300007004 | Agricultural Soil | MKSDTEIIETSNQNDQMQDIESFKINTNSLKLDHRKLR* |
| Ga0066710_1012323721 | 3300009012 | Grasslands Soil | LNEDERDTEIVETSNQNDQMQDIESFKTNPTSSKLDHRKLR |
| Ga0066710_1045064911 | 3300009012 | Grasslands Soil | VKRGTEIIETSNQNNQMQVIESIKINPNSLKLDHRKL |
| Ga0105240_111832191 | 3300009093 | Corn Rhizosphere | LNEGESDTEIIETSNQNSQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0105240_118537351 | 3300009093 | Corn Rhizosphere | SYYRTFERNESDTEIIETSNQNYQIQNIESFKINQNSLKLNHRKLR* |
| Ga0066709_1017544271 | 3300009137 | Grasslands Soil | LNEDERDTEIVETSNQNDQMQDIESFKTNPTSSKLDHRKLK* |
| Ga0066709_1024878362 | 3300009137 | Grasslands Soil | MKSDTEIIETSNQNNQMQDIESFKTNPNSLKLDRRKLK* |
| Ga0066709_1041113821 | 3300009137 | Grasslands Soil | VKCGTEIIETSNQNNQIKVIESIKINPNSLKLDHRKLR* |
| Ga0066709_1042074281 | 3300009137 | Grasslands Soil | MKSDTEIIETSNQNIQMQDIESFKTNPNSLKLDRRKLR* |
| Ga0105248_113711671 | 3300009177 | Switchgrass Rhizosphere | VKRGTEIIETSNQNNQMQVIESFKINPNSLKLDHRKLR* |
| Ga0105248_120289851 | 3300009177 | Switchgrass Rhizosphere | LNEGESDTEIIETSNQNNQMQDIESIKINPNSLKLDHRKLR* |
| Ga0105340_13694521 | 3300009610 | Soil | VKSDTEIIEISNQNSQMQNIESFKTNPNSLNLDHRKLR* |
| Ga0134082_104251891 | 3300010303 | Grasslands Soil | VKHDTEIIETSTQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0134067_102312901 | 3300010321 | Grasslands Soil | TEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0134067_102750511 | 3300010321 | Grasslands Soil | MNIESDTEIIETSNQNKKMQNIESFKINPNLLKLDHRKLR* |
| Ga0134111_104381131 | 3300010329 | Grasslands Soil | MKVKHDTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0134128_100540752 | 3300010373 | Terrestrial Soil | LNKDESDTEIVGTSNQNDQMQVIESFKTNPNSSKLDHRKLRQL* |
| Ga0134126_111180731 | 3300010396 | Terrestrial Soil | TNIKSDTQIIENSNQNKQMQNIESFKINPNLLKFFFK* |
| Ga0134126_120981821 | 3300010396 | Terrestrial Soil | MSDGKIVKTLNQNNQMQDIESFKTNPNSLKLDHRELR* |
| Ga0134123_120215242 | 3300010403 | Terrestrial Soil | MKIKSNTEIVENSNQDVQKQDIESFKTNPNLSKLDYRKLK* |
| Ga0137444_10204792 | 3300011397 | Soil | LNENESDTEIVETSNQNDQMQDIESFKTNPNLSKLDHRKLR* |
| Ga0137348_10616581 | 3300011398 | Soil | MKSDPEIIGTSNQNNQMQDIESFKTNPNSLKLDHRKLS* |
| Ga0137466_10421232 | 3300011399 | Soil | LNEDESDTEIVETSNQNIQMQDIESFKTNPISSKSDHRKLR* |
| Ga0137312_10505181 | 3300011400 | Soil | MKSDTEIIETSNQNYQMQDIESFKTNPNSSKLDHRKLR* |
| Ga0137432_11440071 | 3300011439 | Soil | SDTEIIETSNQNDQMQDIESFKTNPNSSKLDHRKLR* |
| Ga0137427_101351812 | 3300011445 | Soil | MKGDTENVETSNQNNQMQDIKSFKTNPNSLKLDHRKLR* |
| Ga0137431_11759671 | 3300012038 | Soil | MKSDPEIIGTSNQNNQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0137430_11391701 | 3300012041 | Soil | MKMKSDTEIVETSNQNNQMQDIESFKTNPNSSKLDHRKLR* |
| Ga0137344_10857891 | 3300012159 | Soil | MKSDTEIVETSNQKDQMQDIESIKTNPNSLKLDHRKLR* |
| Ga0137336_10769221 | 3300012161 | Soil | LNEVESDTEIVETLNQNNQMQDVESFKTNPNSSNLDHR |
| Ga0137336_10769222 | 3300012161 | Soil | PLNEVESDTEIIETSNQNNQMKDIESFKTNPNSLKLNHRKLR* |
| Ga0137364_114799091 | 3300012198 | Vadose Zone Soil | LNEDERDTEIVETSNQNDQMQDIESFKTNPTSSKLDHRKLR* |
| Ga0137370_104492512 | 3300012285 | Vadose Zone Soil | LNEDERDTEIVETSNQNDQMQDIESFKINPNSSKLDHRKLR* |
| Ga0137370_109648671 | 3300012285 | Vadose Zone Soil | MKSDTKIIETSNQIDQIQDIESFKTNPNSLKLDHRK |
| Ga0137367_111639991 | 3300012353 | Vadose Zone Soil | MKIKSNTEIIETSNQNKKMQNIESFKTNPNSLKLDHRKLREL* |
| Ga0137366_110919431 | 3300012354 | Vadose Zone Soil | TEIIKTSNQNKQMQDIKNFKTNPNSLKLDYRKLR* |
| Ga0137371_102445402 | 3300012356 | Vadose Zone Soil | MKSDTEIIETSNQNIQMQDIESFKTNPNSLKLDRRKLK* |
| Ga0137371_103959562 | 3300012356 | Vadose Zone Soil | LNEDESDTEIVETSNQNDQMQDIESFKTNPNSSKLDHRKLR* |
| Ga0137371_108594271 | 3300012356 | Vadose Zone Soil | LNEVERDTEIVETSNQNDQMQNIESFKANPNSSKLDHRKLR* |
| Ga0137371_113507891 | 3300012356 | Vadose Zone Soil | KHGTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0137368_105947991 | 3300012358 | Vadose Zone Soil | MFKTLNENESDTEYVETSNHNNQMQDVESFKINPNSLKLNCRKLR* |
| Ga0137373_109649591 | 3300012532 | Vadose Zone Soil | LNEGKSDTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0137396_106143751 | 3300012918 | Vadose Zone Soil | MKSDPEIIETSNQNNQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0137419_107477161 | 3300012925 | Vadose Zone Soil | MKSDTEIVETSNQNYQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0164303_115728631 | 3300012957 | Soil | LNEGESDTEIIETSNQNSQMQDIDSFKTNTNSLKLDHRK |
| Ga0164301_109840692 | 3300012960 | Soil | VESDTEIIETSNQNNQMQDIESIRINPNSLKLDHRKLR* |
| Ga0134110_101176251 | 3300012975 | Grasslands Soil | MKSDIEIIKTSNQNNQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0163162_104087491 | 3300013306 | Switchgrass Rhizosphere | VKHGTEIIETSNQNNQMQVIESFKTNPNSLKLDHRKLR* |
| Ga0134081_102358192 | 3300014150 | Grasslands Soil | VESDTEIIETSNQSNQMQNIESFKINPNSLKLDRRKLR* |
| Ga0134081_103701931 | 3300014150 | Grasslands Soil | LNEGKSDTEIIETSNQNSQMQDIESFKTNSDSLKLDYRKLR* |
| Ga0157379_105899601 | 3300014968 | Switchgrass Rhizosphere | LNEGKSDTEIIETSNQNSQMQDIESFKTNPNSLKLDYRKLR* |
| Ga0137418_110653421 | 3300015241 | Vadose Zone Soil | MKSDTEIVETSNQNDQMQDIESFKTNPNSLKLDHRKLR* |
| Ga0134072_100098272 | 3300015357 | Grasslands Soil | VKHYTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR* |
| Ga0134089_103370721 | 3300015358 | Grasslands Soil | VESDTEIIETSNQNRQMQDIESLKTNPDSLKLDHRKLR* |
| Ga0134085_103948181 | 3300015359 | Grasslands Soil | LNEDFSDTKIMATSNHDVQMQDFESFKTNPNSLKLDHRKLR* |
| Ga0184634_102761522 | 3300018031 | Groundwater Sediment | MKSDTEIIETSNQNYQMQDIESFKTNPNSLKLDHRKLR |
| Ga0184620_100291882 | 3300018051 | Groundwater Sediment | LSEVESDTEIIETSNQNNQMQDIESFKTNPNSLKLDHRKLR |
| Ga0184638_11212922 | 3300018052 | Groundwater Sediment | LSEVESDTEIIETSNQNNQMQDIESFKTNPNSLKLDYRKLR |
| Ga0184621_102459652 | 3300018054 | Groundwater Sediment | MKRDTEIVETSNQNDQMQDIESFKTNSNSSKLDHRKLR |
| Ga0184623_103364502 | 3300018056 | Groundwater Sediment | MKSDTEIVETSNQNYQMQDIESFKTNPNSLKLDRRKLR |
| Ga0184619_102172032 | 3300018061 | Groundwater Sediment | LNEVKSDAEFIETSNQNDQMQDIESFKTNPNSLKLDHRKLR |
| Ga0184617_12436361 | 3300018066 | Groundwater Sediment | MKSDTEIIEISNQNSQMQNIESFKTNPNSLNLDHRKLR |
| Ga0184618_103836931 | 3300018071 | Groundwater Sediment | LNEVESDTEIIETSNHNNQMQDIESFKTIPNSSKLDHRKLR |
| Ga0184635_101774891 | 3300018072 | Groundwater Sediment | MKSDTEIVETSNQNDQMQDIESFKTNPNSLKLDHRKLR |
| Ga0184635_101774892 | 3300018072 | Groundwater Sediment | EIESDTEIVETSNQNNQMQDIESFKTNPNSLKLDHRKLR |
| Ga0184632_103050661 | 3300018075 | Groundwater Sediment | LNEVESDTEIVETSNQNYQMQDIESFKTNPNSSKLDHRKLR |
| Ga0184609_103275891 | 3300018076 | Groundwater Sediment | MKCDTEFVETSNQNNQMQDIESFKTNPNSLKLDHRKLR |
| Ga0184625_106704401 | 3300018081 | Groundwater Sediment | LNEVESDTEIVETSNQNNQMQDVESFKTNPNPSNLDHRKLDSFESW |
| Ga0066655_110972991 | 3300018431 | Grasslands Soil | VKHDTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR |
| Ga0066667_101559831 | 3300018433 | Grasslands Soil | LNEGKSDTEIIETSNQNSQMQDIESFKTNPNSLKLDHRKLR |
| Ga0066667_105671841 | 3300018433 | Grasslands Soil | NEDESDTEIVGTSNQNDQMQVIESFKTNPNSSKLDYRKLR |
| Ga0066662_125550541 | 3300018468 | Grasslands Soil | KVASDTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR |
| Ga0066669_112014491 | 3300018482 | Grasslands Soil | VKRGTEIIETSNQNNQMQVIESFKTNPNSLKLDHRKLR |
| Ga0066669_112520742 | 3300018482 | Grasslands Soil | MNIKSDTEIIETSNQNKKMQNIKSFKTNPNSLKLDHRKLR |
| Ga0066669_116503721 | 3300018482 | Grasslands Soil | MKVKRGTEIIETSNQNNQMQVIESFKTNPNLLKLDHRKLR |
| Ga0173479_101989641 | 3300019362 | Soil | VKRGTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR |
| Ga0193756_10530041 | 3300019866 | Soil | LNEVESDTEIVETSNQNIQMQDIESFKTNPNSSKSDHRKLR |
| Ga0193720_10561421 | 3300019868 | Soil | VKSDTEIIEISNQNSQMQNIESFKTNPNSLKLDHRKLR |
| Ga0193754_10307042 | 3300019872 | Soil | MKSDAEIIETSNQNNQMQDIESFKTNPNSLKLDHRKLR |
| Ga0193701_10411851 | 3300019875 | Soil | LNEVESDTEIVETSNQNNQMQDIESFKTNPNSSKLDHRKLR |
| Ga0193701_11001691 | 3300019875 | Soil | LNEDESETEIIETSNQNDQMQDIKSFKTNSNSSKLDHRKLI |
| Ga0193703_10488771 | 3300019876 | Soil | LNEVESDTEIIETSNQNNQMKDIESFKTNPNSLKLDHRKLR |
| Ga0193741_11439732 | 3300019884 | Soil | MKSDTEIVETSDQNDQMHDIESFKTNPNSSELDHRKLK |
| Ga0193710_10225561 | 3300019998 | Soil | MKSDTEIIATSNHNDQMQDIESFKTNPNSLKLDHRKLR |
| Ga0193692_11193211 | 3300020000 | Soil | LNEVESDTEIVETSNQNNQMQDIESFKTNPNSSKSDHRKLR |
| Ga0193734_10388321 | 3300020015 | Soil | MKSDTEIIETSNQNNQMQDIESFKTNPNSLKLDHRKLR |
| Ga0193696_11321932 | 3300020016 | Soil | MKSDTEIIETSNQNDQMQDVKSFKTNPNSLKLDHRKLR |
| Ga0193721_11387341 | 3300020018 | Soil | MKSDTEIIETSNHNNQMQDIESFKTNSNSLKLDHRKLR |
| Ga0210378_103519151 | 3300021073 | Groundwater Sediment | MKSNREIVETSNQNDQMQDIESIKTNPNSLKLDHRKLR |
| Ga0193736_10313311 | 3300021412 | Soil | MKRDTEIVETSNQNDQMQDIESFKTNPNSLKLDNRKL |
| Ga0193695_11337371 | 3300021418 | Soil | MKSDPEIIGTSNQNNQMQDIESFKTNPNSLKLDHRKLR |
| Ga0193737_10518811 | 3300021972 | Soil | MKSDTEIVETSNQNDQMQDIESIKTNPNSLKLDHRKLR |
| Ga0233355_1031071 | 3300024037 | Soil | MKSDTEIVETSNQNNQMQDIESFKTNPNSLKLDHRKLR |
| Ga0209126_10934351 | 3300025119 | Soil | LNEIKSDTEIIGTSNQSDQMQDIESFKTNPNSSKLD |
| Ga0209126_11985001 | 3300025119 | Soil | MKSDAEIVETLNHNNKMQDIKSFKTNPNSSKLDHKKLR |
| Ga0209642_103385512 | 3300025167 | Soil | MKSDAEIVETLNHNNKMQDIKSFKTDPNSSKLDYKKLR |
| Ga0209642_103392012 | 3300025167 | Soil | MKSDTEIIETSNQNDQMQDIKGFKTNPNSLKLDRRKLR |
| Ga0209642_107676931 | 3300025167 | Soil | LNEIKSDTEIIGTSNQSDQMQDIESFKTNPNSSKLDHRKLR |
| Ga0207684_113133661 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LNEGKSDTEIIETSNQNSQMQDIESIKINPNSLKLDHRKLR |
| Ga0207695_110511072 | 3300025913 | Corn Rhizosphere | LNENESDTEFVETSNYNNQMQDVESFKINPNSLKLNHRKLR |
| Ga0207660_110232462 | 3300025917 | Corn Rhizosphere | LNEGESDTEIIETSNQNNQMQDIESIKINPNSLKLDHRKLR |
| Ga0207662_109971412 | 3300025918 | Switchgrass Rhizosphere | LNEGESDTEIIETSNQNSQMQDIESIKINPNSLKLDHRKLR |
| Ga0207640_112099551 | 3300025981 | Corn Rhizosphere | MKVKRGTEIIGTSNQNNLIQDIESIKINPNSLKLDHRK |
| Ga0207677_118425781 | 3300026023 | Miscanthus Rhizosphere | LNEGKSDTVIIETSNQNSQMQDIESFKTNPNSLKLDHRKLR |
| Ga0207703_114103711 | 3300026035 | Switchgrass Rhizosphere | VKHGTEIIETSNQNNQMQVIESIKINPNSLKLDHRKLR |
| Ga0209350_11227032 | 3300026277 | Grasslands Soil | VKHGTEIIETSNQNNQIKVIESIKINPNSLKLDHRKLR |
| Ga0209234_13105821 | 3300026295 | Grasslands Soil | VKHGTEIIETSNQNNQMQVIESIKINPNSLKLDHRKL |
| Ga0209238_12439461 | 3300026301 | Grasslands Soil | MKMWSDTEIIETSNQNNQMQDIESIRINPNSLKLDHR |
| Ga0209239_12798211 | 3300026310 | Grasslands Soil | MKIKSDTEIIETSNQNKKMQNIESFKTNPNSLKLDHRK |
| Ga0209153_12047471 | 3300026312 | Soil | ESVTEIIETSNQNYQIQNIESFKINPNSLKLDHRKLR |
| Ga0209687_10977092 | 3300026322 | Soil | LNKDESDTEIVGTSNQNDQMQVIESFKTNPNSSKLDYRKLR |
| Ga0209152_100210412 | 3300026325 | Soil | VKHDTEIIETSNQNNQMQVIESIKINPNSLKLVHRKLR |
| Ga0209802_11356271 | 3300026328 | Soil | MKIKSDTEIIETSNQNKKMQNIESFKTNPNSLKLDHRKLR |
| Ga0209059_11340502 | 3300026527 | Soil | MNIKSDTEVIETSNQNKKMQNIKSFKTNPNSLKLDHRKLR |
| Ga0208838_1004632 | 3300026915 | Soil | MKVKRGTEIIETSNQNIQMQVIESIKINPNSLKLDHRKLR |
| Ga0209818_12655571 | 3300027637 | Agricultural Soil | MKSDTEIIETSNQNDQMQDIKGFKTNPNSLKLDCRKLR |
| Ga0209486_104277361 | 3300027886 | Agricultural Soil | INFSYNRTLNEIKSDTEIIGTSNQIDQMQDIESFKTNPNSSKLDHRKLR |
| Ga0247689_10248831 | 3300028281 | Soil | VKHGTEIIETSNQNNQMQVIESFKINPNSLKLDHRKLR |
| Ga0302046_112450891 | 3300030620 | Soil | LNEVVSDTEIIETSNHSNQMQDIESFKTNPNSLKF |
| Ga0307499_102640671 | 3300031184 | Soil | MKMKSDTEIIATSNHNDQMHDIESFKTNPNPSNLDHRKLR |
| Ga0299913_104083151 | 3300031229 | Soil | LNEIKSDTEIVETSNQNNQMQDIKSFKTNPNSSKLDYRKLR |
| Ga0307513_104613811 | 3300031456 | Ectomycorrhiza | MKMKSDTEIVETSDQNDQMNDIESFKTNPNSSELDHRKLK |
| Ga0307513_106375422 | 3300031456 | Ectomycorrhiza | MIKTLNEDESDTEIVETSNQNNQIQDIKSFKTNPNSLKLDYRKLRWL |
| Ga0307513_108882591 | 3300031456 | Ectomycorrhiza | MKSDPEIIETSNQNNQMQDIESFKTNPNSLKLDHRKLR |
| Ga0364928_0155576_205_330 | 3300033813 | Sediment | LNEDESDTEIVETSNHNNQMQDIESFKTNPNSSKLDHRKLR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |