| Basic Information | |
|---|---|
| Family ID | F035945 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSDFPHKSERVSGLEAWALALATALVALIAVGVVPHVHW |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.93 % |
| % of genes near scaffold ends (potentially truncated) | 23.98 % |
| % of genes from short scaffolds (< 2000 bps) | 81.29 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.819 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (7.602 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.883 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF03601 | Cons_hypoth698 | 9.36 |
| PF00667 | FAD_binding_1 | 7.02 |
| PF03061 | 4HBT | 4.09 |
| PF00258 | Flavodoxin_1 | 3.51 |
| PF03460 | NIR_SIR_ferr | 1.75 |
| PF02738 | MoCoBD_1 | 1.75 |
| PF01799 | Fer2_2 | 1.17 |
| PF00596 | Aldolase_II | 0.58 |
| PF03861 | ANTAR | 0.58 |
| PF01036 | Bac_rhodopsin | 0.58 |
| PF13279 | 4HBT_2 | 0.58 |
| PF13379 | NMT1_2 | 0.58 |
| PF01315 | Ald_Xan_dh_C | 0.58 |
| PF01618 | MotA_ExbB | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 9.36 |
| COG0369 | Flavoprotein (flavin reductase) subunit CysJ of sulfite and N-hydroxylaminopurine reductases | Nucleotide transport and metabolism [F] | 7.02 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.58 |
| COG5524 | Bacteriorhodopsin | Signal transduction mechanisms [T] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.82 % |
| Unclassified | root | N/A | 39.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2044078003|MGB_F548DK201D8D6X | Not Available | 500 | Open in IMG/M |
| 2228664022|INPgaii200_c0347775 | Not Available | 517 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101644274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2909 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101644801 | Not Available | 804 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1057454 | Not Available | 596 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10104552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10145312 | Not Available | 572 | Open in IMG/M |
| 3300004020|Ga0055440_10005841 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
| 3300004024|Ga0055436_10000899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4766 | Open in IMG/M |
| 3300004281|Ga0066397_10027115 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300004463|Ga0063356_100337132 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300004479|Ga0062595_100499674 | Not Available | 913 | Open in IMG/M |
| 3300004480|Ga0062592_102633141 | Not Available | 508 | Open in IMG/M |
| 3300004633|Ga0066395_10043116 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300005162|Ga0066814_10020750 | Not Available | 911 | Open in IMG/M |
| 3300005162|Ga0066814_10103106 | Not Available | 536 | Open in IMG/M |
| 3300005163|Ga0066823_10092264 | Not Available | 610 | Open in IMG/M |
| 3300005168|Ga0066809_10021794 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300005168|Ga0066809_10075826 | Not Available | 791 | Open in IMG/M |
| 3300005183|Ga0068993_10161204 | Not Available | 761 | Open in IMG/M |
| 3300005206|Ga0068995_10025353 | Not Available | 949 | Open in IMG/M |
| 3300005329|Ga0070683_100241333 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300005332|Ga0066388_100691344 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300005332|Ga0066388_100787488 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300005332|Ga0066388_101450092 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300005332|Ga0066388_107705299 | Not Available | 539 | Open in IMG/M |
| 3300005332|Ga0066388_108462946 | Not Available | 512 | Open in IMG/M |
| 3300005335|Ga0070666_10114216 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300005363|Ga0008090_15447400 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300005364|Ga0070673_102139066 | Not Available | 532 | Open in IMG/M |
| 3300005434|Ga0070709_10001129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14726 | Open in IMG/M |
| 3300005434|Ga0070709_10089944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2022 | Open in IMG/M |
| 3300005434|Ga0070709_10772093 | Not Available | 752 | Open in IMG/M |
| 3300005445|Ga0070708_100216363 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300005529|Ga0070741_10008999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 19675 | Open in IMG/M |
| 3300005535|Ga0070684_101181619 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005617|Ga0068859_102807095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. B501 | 534 | Open in IMG/M |
| 3300005713|Ga0066905_100126816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1793 | Open in IMG/M |
| 3300005713|Ga0066905_100850392 | Not Available | 795 | Open in IMG/M |
| 3300005718|Ga0068866_10121936 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300005764|Ga0066903_100026028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6444 | Open in IMG/M |
| 3300005764|Ga0066903_103000935 | Not Available | 914 | Open in IMG/M |
| 3300005834|Ga0068851_10119666 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300005937|Ga0081455_10000673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 44258 | Open in IMG/M |
| 3300006028|Ga0070717_10203468 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300006047|Ga0075024_100162211 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300006047|Ga0075024_100406494 | Not Available | 694 | Open in IMG/M |
| 3300006048|Ga0075363_100692527 | Not Available | 615 | Open in IMG/M |
| 3300006050|Ga0075028_100442840 | Not Available | 750 | Open in IMG/M |
| 3300006057|Ga0075026_100104239 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300006172|Ga0075018_10195333 | Not Available | 957 | Open in IMG/M |
| 3300006172|Ga0075018_10553815 | Not Available | 606 | Open in IMG/M |
| 3300006175|Ga0070712_102052271 | Not Available | 501 | Open in IMG/M |
| 3300006573|Ga0074055_11668634 | Not Available | 607 | Open in IMG/M |
| 3300006806|Ga0079220_10287715 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300006854|Ga0075425_100289891 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300006854|Ga0075425_102047685 | Not Available | 639 | Open in IMG/M |
| 3300006871|Ga0075434_101113567 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300006931|Ga0097620_100177721 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300006954|Ga0079219_10006347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3657 | Open in IMG/M |
| 3300009078|Ga0105106_10717965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300009090|Ga0099827_11608563 | Not Available | 566 | Open in IMG/M |
| 3300009092|Ga0105250_10617647 | Not Available | 504 | Open in IMG/M |
| 3300009094|Ga0111539_10796306 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300009162|Ga0075423_12386116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300009792|Ga0126374_10547586 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300010046|Ga0126384_10131116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1902 | Open in IMG/M |
| 3300010046|Ga0126384_10271075 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300010047|Ga0126382_10048458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2471 | Open in IMG/M |
| 3300010047|Ga0126382_11195017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300010360|Ga0126372_10386096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1272 | Open in IMG/M |
| 3300010361|Ga0126378_13431040 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010371|Ga0134125_10070680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3882 | Open in IMG/M |
| 3300010371|Ga0134125_10377590 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300010371|Ga0134125_11689241 | Not Available | 689 | Open in IMG/M |
| 3300010376|Ga0126381_100247838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2412 | Open in IMG/M |
| 3300010401|Ga0134121_10282499 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300010863|Ga0124850_1068374 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300011000|Ga0138513_100012893 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300012480|Ga0157346_1025396 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012483|Ga0157337_1003445 | Not Available | 957 | Open in IMG/M |
| 3300012491|Ga0157329_1004379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 913 | Open in IMG/M |
| 3300012493|Ga0157355_1002882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1007 | Open in IMG/M |
| 3300012495|Ga0157323_1032601 | Not Available | 561 | Open in IMG/M |
| 3300012500|Ga0157314_1007107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300012884|Ga0157300_1036809 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012913|Ga0157298_10335314 | Not Available | 551 | Open in IMG/M |
| 3300012931|Ga0153915_11626212 | Not Available | 756 | Open in IMG/M |
| 3300012948|Ga0126375_10207475 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300012948|Ga0126375_10446844 | Not Available | 948 | Open in IMG/M |
| 3300012951|Ga0164300_10015376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2530 | Open in IMG/M |
| 3300012986|Ga0164304_10002016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 7214 | Open in IMG/M |
| 3300014325|Ga0163163_10101332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2902 | Open in IMG/M |
| 3300014968|Ga0157379_11764793 | Not Available | 607 | Open in IMG/M |
| 3300014969|Ga0157376_11451193 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300015371|Ga0132258_10015812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16172 | Open in IMG/M |
| 3300015371|Ga0132258_13758952 | Not Available | 1034 | Open in IMG/M |
| 3300015372|Ga0132256_100333581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1608 | Open in IMG/M |
| 3300015372|Ga0132256_102336034 | Not Available | 638 | Open in IMG/M |
| 3300015373|Ga0132257_101008296 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300015373|Ga0132257_102171977 | Not Available | 718 | Open in IMG/M |
| 3300015374|Ga0132255_105014334 | Not Available | 561 | Open in IMG/M |
| 3300017792|Ga0163161_10954885 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300017944|Ga0187786_10024108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1645 | Open in IMG/M |
| 3300017944|Ga0187786_10353716 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300017947|Ga0187785_10010173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3180 | Open in IMG/M |
| 3300017947|Ga0187785_10013555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2807 | Open in IMG/M |
| 3300017973|Ga0187780_10360183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1028 | Open in IMG/M |
| 3300017973|Ga0187780_10711852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300018028|Ga0184608_10040158 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300018029|Ga0187787_10204352 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300018054|Ga0184621_10237023 | Not Available | 652 | Open in IMG/M |
| 3300018060|Ga0187765_10910609 | Not Available | 596 | Open in IMG/M |
| 3300018067|Ga0184611_1122279 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300018073|Ga0184624_10497291 | Not Available | 531 | Open in IMG/M |
| 3300019356|Ga0173481_10000576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 8078 | Open in IMG/M |
| 3300021560|Ga0126371_10165141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2287 | Open in IMG/M |
| 3300021560|Ga0126371_12198995 | Not Available | 666 | Open in IMG/M |
| 3300022901|Ga0247788_1041427 | Not Available | 845 | Open in IMG/M |
| 3300024232|Ga0247664_1147203 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300024310|Ga0247681_1050334 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025538|Ga0210132_1002256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2393 | Open in IMG/M |
| 3300025558|Ga0210139_1055848 | Not Available | 799 | Open in IMG/M |
| 3300025735|Ga0207713_1150731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 751 | Open in IMG/M |
| 3300025912|Ga0207707_10263536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1495 | Open in IMG/M |
| 3300025915|Ga0207693_10405486 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300025918|Ga0207662_10777027 | Not Available | 674 | Open in IMG/M |
| 3300025944|Ga0207661_10281124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1487 | Open in IMG/M |
| 3300025981|Ga0207640_10045575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2817 | Open in IMG/M |
| 3300026452|Ga0256821_1038530 | Not Available | 547 | Open in IMG/M |
| 3300026900|Ga0207444_1007274 | Not Available | 763 | Open in IMG/M |
| 3300026933|Ga0207578_1004420 | Not Available | 915 | Open in IMG/M |
| 3300026995|Ga0208761_1035605 | Not Available | 513 | Open in IMG/M |
| 3300027443|Ga0207477_102726 | Not Available | 577 | Open in IMG/M |
| 3300027483|Ga0207637_1000932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1379 | Open in IMG/M |
| 3300027523|Ga0208890_1005636 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300027560|Ga0207981_1006635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2051 | Open in IMG/M |
| 3300027775|Ga0209177_10074318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1023 | Open in IMG/M |
| 3300028379|Ga0268266_10769515 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300028380|Ga0268265_11871362 | Not Available | 607 | Open in IMG/M |
| 3300028715|Ga0307313_10044388 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300028768|Ga0307280_10021674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1854 | Open in IMG/M |
| 3300028784|Ga0307282_10004309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5411 | Open in IMG/M |
| 3300028793|Ga0307299_10137065 | Not Available | 919 | Open in IMG/M |
| 3300028793|Ga0307299_10153677 | Not Available | 866 | Open in IMG/M |
| 3300031231|Ga0170824_108222292 | Not Available | 572 | Open in IMG/M |
| 3300031241|Ga0265325_10000036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 96858 | Open in IMG/M |
| 3300031421|Ga0308194_10213999 | Not Available | 630 | Open in IMG/M |
| 3300031538|Ga0310888_10521759 | Not Available | 713 | Open in IMG/M |
| 3300031543|Ga0318516_10189196 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300031545|Ga0318541_10000443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 13536 | Open in IMG/M |
| 3300031561|Ga0318528_10266082 | Not Available | 920 | Open in IMG/M |
| 3300031562|Ga0310886_10003109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5374 | Open in IMG/M |
| 3300031716|Ga0310813_10018023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4758 | Open in IMG/M |
| 3300031736|Ga0318501_10697252 | Not Available | 560 | Open in IMG/M |
| 3300031740|Ga0307468_101163107 | Not Available | 692 | Open in IMG/M |
| 3300031820|Ga0307473_10924261 | Not Available | 632 | Open in IMG/M |
| 3300031854|Ga0310904_10004031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5295 | Open in IMG/M |
| 3300031880|Ga0318544_10076898 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300031892|Ga0310893_10474641 | Not Available | 558 | Open in IMG/M |
| 3300031943|Ga0310885_10690548 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300032054|Ga0318570_10185723 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300032205|Ga0307472_100096712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2018 | Open in IMG/M |
| 3300032770|Ga0335085_12133241 | Not Available | 565 | Open in IMG/M |
| 3300032829|Ga0335070_10759362 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300032897|Ga0335071_11223969 | Not Available | 696 | Open in IMG/M |
| 3300033004|Ga0335084_10066668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3724 | Open in IMG/M |
| 3300033433|Ga0326726_10259461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1620 | Open in IMG/M |
| 3300033758|Ga0314868_019534 | Not Available | 724 | Open in IMG/M |
| 3300033760|Ga0314870_014588 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300034644|Ga0370548_044252 | Not Available | 775 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.09% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.51% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.34% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.58% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.58% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.58% |
| Switchgrass, Maize And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Switchgrass, Maize And Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.58% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.58% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.58% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2044078003 | Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300026900 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026933 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027443 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027483 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| 3300033760 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_C | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MGB_1552590 | 2044078003 | Switchgrass, Maize And Miscanthus Rhizosphere | MSDFPHEFERISGLEAWALALATALVALIAIGIVPHVHW |
| INPgaii200_03477751 | 2228664022 | Soil | MSDFPHKSERVSGLEAWALALATALVALIAVGVVPHVHW |
| INPhiseqgaiiFebDRAFT_1016442742 | 3300000364 | Soil | MSDFPHKSERVSGLEAWALALATALVALIAVGVVPHVHW* |
| INPhiseqgaiiFebDRAFT_1016448012 | 3300000364 | Soil | MSDFPHESERISGLEAWVLALATALVALIAIGIVPHVHW* |
| AF_2010_repII_A01DRAFT_10574542 | 3300000580 | Forest Soil | MPDFPHESERISGLEAWALAFAMALVALIAIGIVPHVHW* |
| AF_2010_repII_A1DRAFT_101045523 | 3300000597 | Forest Soil | MSDFPHESERISGLEAWALAFAMALVALIAIGIVPHVHW* |
| AF_2010_repII_A1DRAFT_101453122 | 3300000597 | Forest Soil | MSDVPHKSERVSGLEAWALALATALVALIAVGVIPHLHW* |
| Ga0055440_100058412 | 3300004020 | Natural And Restored Wetlands | MSDFPHESERISGLEAWALAFATALVALIAIGIVPHVHW* |
| Ga0055436_100008995 | 3300004024 | Natural And Restored Wetlands | MSDFSHESERISGLEAWALAFATALVALIAIGIVPHAHW* |
| Ga0066397_100271151 | 3300004281 | Tropical Forest Soil | MSDVPHKSERLSGLEAWALALATALVALIAVGVIPHLHW* |
| Ga0063356_1003371322 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSDFPHEPERVSQLEAWTLALATALVALIAVGVVPHVHW* |
| Ga0062595_1004996741 | 3300004479 | Soil | MSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMHW* |
| Ga0062592_1026331411 | 3300004480 | Soil | MSDFPHESERISGLEAWALALATALVALIAIGIVPHVDW* |
| Ga0066395_100431162 | 3300004633 | Tropical Forest Soil | MSDVPHKSERISGLEAWALALATALVALIAVGVIPHLHW* |
| Ga0066814_100207501 | 3300005162 | Soil | MSDFPHESERISGLEAWALALATALVALIAIGIVPHVHW* |
| Ga0066814_101031061 | 3300005162 | Soil | MSDFPHKSERVSGLEAWALALATALVALIAVGVIPHVHW* |
| Ga0066823_100922642 | 3300005163 | Soil | MGAVPMSDFPNKSERVSGLEAWALALATALVALIAVGVIPHVHW* |
| Ga0066809_100217942 | 3300005168 | Soil | MSDFPNKSERVSGLEAWALALATALVALIAVGVIPHVHW* |
| Ga0066809_100758262 | 3300005168 | Soil | MSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW* |
| Ga0068993_101612042 | 3300005183 | Natural And Restored Wetlands | MSDFSHESERISGLEAWALAFATALVALIAIGIVPHVHW* |
| Ga0068995_100253532 | 3300005206 | Natural And Restored Wetlands | MSDFPHVYKRISGLEAWALAFATALVALIAIGIVPHVHW* |
| Ga0070683_1002413332 | 3300005329 | Corn Rhizosphere | MSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW* |
| Ga0066388_1006913443 | 3300005332 | Tropical Forest Soil | MRNFPHKSERLSGLEAWALALATALVALIAVGVFPHGHW* |
| Ga0066388_1007874883 | 3300005332 | Tropical Forest Soil | MSDFRHKSKRVSGLEAWALALATALVALIAVGVVPHAHW* |
| Ga0066388_1014500922 | 3300005332 | Tropical Forest Soil | MSDFPRKSGRISGLEVWAFALATTLVALIAVGVVPLGHW* |
| Ga0066388_1077052992 | 3300005332 | Tropical Forest Soil | MSDVPRKSERLSGMEAWALALATALVALIAVGVIPHLYW* |
| Ga0066388_1084629462 | 3300005332 | Tropical Forest Soil | MSDVPHKSERLSGLEAWTLALATALVALIAVGVIPHLHW* |
| Ga0070666_101142162 | 3300005335 | Switchgrass Rhizosphere | MSDLPRKSERVPGLEVWAFALATTLVALIAVGVVPHGHW* |
| Ga0008090_154474001 | 3300005363 | Tropical Rainforest Soil | MSDFPNESERISGLEAWALAFAMALVALIAIGIVPHVHW* |
| Ga0070673_1021390662 | 3300005364 | Switchgrass Rhizosphere | SCRWMGAVPMSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW* |
| Ga0070709_100011297 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW* |
| Ga0070709_100899442 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEFPRKSNRVSRLEALAFAFATALVALIAVGVVPGLHG* |
| Ga0070709_107720931 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDFPHEPKRVSRLEAWAFALATVLVALIAVGVVPRVHW* |
| Ga0070708_1002163631 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDFPHKRERISGLEAWAFAFAAALVVLIVVGIVPQVHW* |
| Ga0070741_100089999 | 3300005529 | Surface Soil | MSDLPHEPERVSALEAWALALATALVALIAIGIVPHVHW* |
| Ga0070684_1011816192 | 3300005535 | Corn Rhizosphere | MGAVPMSDLPRKSERVPGLEVWAFALATTLVALIAVGVVPHGHW* |
| Ga0068859_1028070951 | 3300005617 | Switchgrass Rhizosphere | GSCRWMGAVPMSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW* |
| Ga0066905_1001268164 | 3300005713 | Tropical Forest Soil | MSDVPRKSERLSGLEAWALALATALVALIAVGVIPHLHW* |
| Ga0066905_1008503922 | 3300005713 | Tropical Forest Soil | LLEMGAVPMRNFPHKSERLSGLEAWALALATALVALIAVGVFPHGHW* |
| Ga0068866_101219361 | 3300005718 | Miscanthus Rhizosphere | MCDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW* |
| Ga0066903_1000260286 | 3300005764 | Tropical Forest Soil | MSDVPHKSERVSGLEAWALAFATALIALIAVGVIPHVHW* |
| Ga0066903_1030009352 | 3300005764 | Tropical Forest Soil | MSDVPHKSERISGLEAWALALATALVALIDVGVIPHLHW* |
| Ga0068851_101196662 | 3300005834 | Corn Rhizosphere | MSDFSHEPERSRLEAWSLALATALVALIAIGIVPHMHW* |
| Ga0081455_100006739 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSDFPHESERISGLEAWALAFATALVALIAIGIVPHAHW* |
| Ga0070717_102034682 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEFPRKPNRVSRLEALAFAFATALVALIAVGVVPGLHG* |
| Ga0075024_1001622112 | 3300006047 | Watersheds | MTGFPQEPERVLGLEAWAPALATALVALIAVGVVPHVHW* |
| Ga0075024_1004064942 | 3300006047 | Watersheds | MSDFLNKSERVSGLEAWALALATALVALIAVGVIPHVHW* |
| Ga0075363_1006925271 | 3300006048 | Populus Endosphere | SRGSVTGAGPMSDFPHESERISGLEAWALALATALVALIAIGIVPHVHW* |
| Ga0075028_1004428402 | 3300006050 | Watersheds | MTDFPHEPERISGLEAWALALATALVALIAVGVVPHVHW* |
| Ga0075026_1001042392 | 3300006057 | Watersheds | MSDFPNKSERVSGLETWALALATALVALIAVGVIPHVHW* |
| Ga0075018_101953332 | 3300006172 | Watersheds | MSDFPNKSERVSGVEAWALALATALVALIAVGVIPHVHW* |
| Ga0075018_105538151 | 3300006172 | Watersheds | HEPERISGLEAWALALATALVALIAVGVVPHVHW* |
| Ga0070712_1020522711 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDFPHKSKRVSGLEAWALALATALVALIAVGVVPHVHW* |
| Ga0074055_116686342 | 3300006573 | Soil | SRGSVTGASPMSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW* |
| Ga0079220_102877152 | 3300006806 | Agricultural Soil | MSDFPHEPERVSPLEAWTLALAAALVALIAVGVIPHVHW* |
| Ga0075425_1002898911 | 3300006854 | Populus Rhizosphere | MSDLPRKSERVSGLEVWAFALATTLVALIAIGVVPHGHW* |
| Ga0075425_1020476852 | 3300006854 | Populus Rhizosphere | GSCRWMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW* |
| Ga0075434_1011135671 | 3300006871 | Populus Rhizosphere | MSDFPHESERISGLEAWALALATALVALIAIGIVPH |
| Ga0097620_1001777213 | 3300006931 | Switchgrass Rhizosphere | MSDFPHEFERISGLEAWALALATALVALIAIGIVPHVHW* |
| Ga0079219_100063476 | 3300006954 | Agricultural Soil | MSDLPRKSGRVSGLEVWAFALATTLVVLIAIGVVRHGHW* |
| Ga0105106_107179651 | 3300009078 | Freshwater Sediment | MGADPMTDFPRGPERVSAIESWALAIATALVALIAVGVLPRVGW* |
| Ga0099827_116085632 | 3300009090 | Vadose Zone Soil | MEPIPMSDFPHKPERISGLEAWAFAFATALAALIVVGVVPQVHW* |
| Ga0105250_106176472 | 3300009092 | Switchgrass Rhizosphere | MSDFSHEPERISRLEAWSLALATALVALIAIGIVPHVHW* |
| Ga0111539_107963062 | 3300009094 | Populus Rhizosphere | MGAVPMSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW* |
| Ga0075423_123861163 | 3300009162 | Populus Rhizosphere | YIMVLVAGMGAPPMSDFPHKSKRVSGLEAWALALATALVALIAVGVVPHVHW* |
| Ga0126374_105475862 | 3300009792 | Tropical Forest Soil | MASVSGNGSRLMSDVPHKSERLSGLEAWALALATALVALIAVGVIPHLHW* |
| Ga0126384_101311163 | 3300010046 | Tropical Forest Soil | MSNFPRKPERISGLEAWTFAFATALVALIVLGILPQVHW* |
| Ga0126384_102710753 | 3300010046 | Tropical Forest Soil | MSDFPNESERISGLEAWALALATALVALIAIGIVPHVHW* |
| Ga0126382_100484582 | 3300010047 | Tropical Forest Soil | MSDVPHKLERLSGLEAWALALATALVALIAVGVIPHLHW* |
| Ga0126382_111950171 | 3300010047 | Tropical Forest Soil | MSDVPRKRSSGLGVLAFALATTLVALIAVGVVPHGHW* |
| Ga0126372_103860961 | 3300010360 | Tropical Forest Soil | MSDFPNESERISGLEAWALAFAMALVALIAIGIVPHAHW* |
| Ga0126378_134310401 | 3300010361 | Tropical Forest Soil | MASVSGNGSRLMSDVPHKSERLSGLEAWALALATALVALIAV |
| Ga0134125_100706802 | 3300010371 | Terrestrial Soil | MGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW* |
| Ga0134125_103775901 | 3300010371 | Terrestrial Soil | MSDFSHEPERISRLEAWAFALATALVALIAIGIVPHVHW* |
| Ga0134125_116892412 | 3300010371 | Terrestrial Soil | MSDFPHEPERVSALEAWALAFATALVALIAVGVIPHVHW* |
| Ga0126381_1002478382 | 3300010376 | Tropical Forest Soil | MSDVPHKSERVSGLEAWALALATALVALIDVGVIPHLHW* |
| Ga0134121_102824992 | 3300010401 | Terrestrial Soil | VTGAGPMSDFPHEFERISGLEAWALALATALVALIAIGIVPHVHW* |
| Ga0124850_10683741 | 3300010863 | Tropical Forest Soil | MSDVPRKSERLSGLEAWALALATALVALIAVGVIPH |
| Ga0138513_1000128932 | 3300011000 | Soil | MSDSPDKRKRVSRLEAWAFAFATALVALITIGVVPTVHW* |
| Ga0157346_10253962 | 3300012480 | Arabidopsis Rhizosphere | MGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVP |
| Ga0157337_10034452 | 3300012483 | Arabidopsis Rhizosphere | MGAVPMSDLPRKSGRVSGLEVWAFALATTLVALIAVGIVPHGHW* |
| Ga0157329_10043792 | 3300012491 | Arabidopsis Rhizosphere | MSDLPRKSERVSGLEVWAFALATTLVVLIAIGVVPHGHW* |
| Ga0157355_10028822 | 3300012493 | Unplanted Soil | MGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAIGVVPHGHW* |
| Ga0157323_10326012 | 3300012495 | Arabidopsis Rhizosphere | MGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGIVPHGHW* |
| Ga0157314_10071072 | 3300012500 | Arabidopsis Rhizosphere | MGAVPMSDLPRKSERVSGLEVWAFALATTLVALTAVGVVPHGHW* |
| Ga0157300_10368091 | 3300012884 | Soil | MSDFSHEPERISRLEAWSLALATALVALIAIGIVP |
| Ga0157298_103353142 | 3300012913 | Soil | MSDFPHESERISRLEAWALALATALVALIAIGIVPHVHW* |
| Ga0153915_116262121 | 3300012931 | Freshwater Wetlands | MTDFPHEPERVSGLEAWALALATALVALIAVGVVPHVHW* |
| Ga0126375_102074752 | 3300012948 | Tropical Forest Soil | MSDFSHESERISGLEAWALALATALVALIAIGIVPHVHW* |
| Ga0126375_104468442 | 3300012948 | Tropical Forest Soil | MSDVPHKSERLSGLEGWALALATALVALIAVGVIPHLHW* |
| Ga0164300_100153761 | 3300012951 | Soil | PMSDLPRKSERVSGLEVWAFALATTPVALIAVGVVPHGHW* |
| Ga0164304_100020164 | 3300012986 | Soil | MSDFSHEPERISRLEAWSLALATALVAVIAIGIVPHMHW* |
| Ga0163163_101013322 | 3300014325 | Switchgrass Rhizosphere | MGAVPISDLQRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW* |
| Ga0157379_117647931 | 3300014968 | Switchgrass Rhizosphere | GAGPMSDFPHESERISGLEAWALALATALVALIAIGIVPHVHW* |
| Ga0157376_114511932 | 3300014969 | Miscanthus Rhizosphere | MGAVPMSDLPRKSERVSGLEIWAFALATTLVSLIAVGVVPHGHW* |
| Ga0132258_100158125 | 3300015371 | Arabidopsis Rhizosphere | MSDFPHEPERVSALETWALALATALVALIAIGIVPHVHW* |
| Ga0132258_137589522 | 3300015371 | Arabidopsis Rhizosphere | MSDFSHEPERISRLEAWVLALATALVALIAIGIVPHMHW* |
| Ga0132256_1003335811 | 3300015372 | Arabidopsis Rhizosphere | MGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGIVPHG |
| Ga0132256_1023360342 | 3300015372 | Arabidopsis Rhizosphere | MSDFSHEPERISGLEAWALALATALVALIAIGVVPHVHW* |
| Ga0132257_1010082962 | 3300015373 | Arabidopsis Rhizosphere | MSDFPRKSDRVSGLEVWAFALATTLVALIAVGIVPHGHW* |
| Ga0132257_1021719772 | 3300015373 | Arabidopsis Rhizosphere | SCRWMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAIGVVPHGHW* |
| Ga0132255_1050143342 | 3300015374 | Arabidopsis Rhizosphere | MSDFPHESERISGLEAWALALATALVALIAIGIVPHMHW* |
| Ga0163161_109548852 | 3300017792 | Switchgrass Rhizosphere | MGAVPISDLQRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW |
| Ga0187786_100241082 | 3300017944 | Tropical Peatland | MSDVPHKAERVSGLEAWALAFATALIALIAVGVIPHVHW |
| Ga0187786_103537161 | 3300017944 | Tropical Peatland | MTDFPHEPERVSGLEAWTLAFATALVALIAIGVVPHVHW |
| Ga0187785_100101732 | 3300017947 | Tropical Peatland | MSDFPRKSGRISGLEVWAFALATTLVALIAVGVVPLGHW |
| Ga0187785_100135555 | 3300017947 | Tropical Peatland | MTNRPHEPKRISRLEAWAFTLAATLVALIAIGVVPRVHG |
| Ga0187780_103601832 | 3300017973 | Tropical Peatland | MTDFPHEPERMSGLEAWALAFATALVALIAIGVVPHVHW |
| Ga0187780_107118522 | 3300017973 | Tropical Peatland | MTDFPHEPKRISRLEAWAFALATTLVALIAIGVVPRVHG |
| Ga0184608_100401582 | 3300018028 | Groundwater Sediment | MSDFPHKPERVSGLEAWALAFATALVALIVVGVVPQVHW |
| Ga0187787_102043521 | 3300018029 | Tropical Peatland | MTKSPHEPKRVSRLEAWAFALATALVALIAIGLMPGVHG |
| Ga0184621_102370232 | 3300018054 | Groundwater Sediment | MSDVPHKPERVSGLEAWALALATALVALIAVGVIPHVHW |
| Ga0187765_109106091 | 3300018060 | Tropical Peatland | MTDFPHEPERISGLEAWALAFATALVALIAIGVVPHVHW |
| Ga0184611_11222792 | 3300018067 | Groundwater Sediment | MSDSPDKRKRVSRLEAWAFAFATALVALITIGVVPTVHW |
| Ga0184624_104972912 | 3300018073 | Groundwater Sediment | MSDVPHKSERVSGLEAWALALATALVALIAVGVIPHVHW |
| Ga0173481_100005765 | 3300019356 | Soil | MSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMHW |
| Ga0126371_101651412 | 3300021560 | Tropical Forest Soil | MSDVPHKSERVSGLEAWALALATALVALIAVGVIPHLHW |
| Ga0126371_121989952 | 3300021560 | Tropical Forest Soil | MSDFRHKSKQVSGLEAWALALATALVALIAVGVVPHAHW |
| Ga0247788_10414271 | 3300022901 | Soil | PMSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMHW |
| Ga0247664_11472031 | 3300024232 | Soil | MGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW |
| Ga0247681_10503341 | 3300024310 | Soil | MSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHG |
| Ga0210132_10022561 | 3300025538 | Natural And Restored Wetlands | MSDFPHESERISGLEAWALAFATALVALIAIGIVPHAHW |
| Ga0210139_10558482 | 3300025558 | Natural And Restored Wetlands | MSDFSHESERISGLEAWALAFATALVALIAIGIVPHVHW |
| Ga0207713_11507312 | 3300025735 | Switchgrass Rhizosphere | MSDLPRKSERVPGLEVWAFALATTLVALIAVGVVPHGHW |
| Ga0207707_102635362 | 3300025912 | Corn Rhizosphere | MSDFPHESERISGLEAWALALATALVALIAIGIVPHVHW |
| Ga0207693_104054861 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PMTDFPHEPKRVSRLEAWAFALATVLVALIAVGVVPRVHW |
| Ga0207662_107770272 | 3300025918 | Switchgrass Rhizosphere | PMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW |
| Ga0207661_102811242 | 3300025944 | Corn Rhizosphere | MSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW |
| Ga0207640_100455753 | 3300025981 | Corn Rhizosphere | MSDFSHEPERFRGWKPWSLALATALVALIAIGIVPHMHW |
| Ga0256821_10385302 | 3300026452 | Sediment | MSDFPHESERISGLEAWALAFATALVALIAIGIVPHVHW |
| Ga0207444_10072741 | 3300026900 | Soil | FSHEPERISRLEAWSLALATALVALIAIGIVPHMHW |
| Ga0207578_10044201 | 3300026933 | Soil | SVTGAGPMSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMHW |
| Ga0208761_10356051 | 3300026995 | Soil | GMGAVPMSDFPNKSERVSGLEAWALALATALVALIAVGVIPHVHW |
| Ga0207477_1027262 | 3300027443 | Soil | MSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMH |
| Ga0207637_10009322 | 3300027483 | Soil | MSDFSHEPERISRLEAWSLALATALVAVIAIGIVPHMHW |
| Ga0208890_10056362 | 3300027523 | Soil | GSVTGASPMSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW |
| Ga0207981_10066352 | 3300027560 | Soil | MSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW |
| Ga0209177_100743182 | 3300027775 | Agricultural Soil | MSDFPHEPERVSPLEAWTLALAAALVALIAVGVIPHVHW |
| Ga0268266_107695152 | 3300028379 | Switchgrass Rhizosphere | MSDFSHEPERISRLEAWSLALATALVALIAIGIVPHM |
| Ga0268265_118713621 | 3300028380 | Switchgrass Rhizosphere | MSDFPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW |
| Ga0307313_100443882 | 3300028715 | Soil | IVAGNGSRLMSDVPHKPERVSGLEAWALALATALVALIAVGVIPHVHW |
| Ga0307280_100216741 | 3300028768 | Soil | MSDVPHKSERVSGLEAWALALATALIALIAVGVVPHVHW |
| Ga0307282_100043091 | 3300028784 | Soil | TYLLLEIGAVPMSDVPHKSERVSGLEAWALALATALIALTAVGVVPHVHW |
| Ga0307299_101370651 | 3300028793 | Soil | NGSRLMSDVPHKPERVSGLEAWALALATALVALIAVGVIPHVHW |
| Ga0307299_101536771 | 3300028793 | Soil | MSDVPHKSERVSGLEAWALALATALIALAAVGVVPHVHW |
| Ga0170824_1082222922 | 3300031231 | Forest Soil | MTEFPNKPKRVSRLEAWAFALATTLVALIAIGVLPGVRG |
| Ga0265325_1000003619 | 3300031241 | Rhizosphere | MTDFPHKPKGVSRLEAWAFALATALVVLIAIGVVPGVHG |
| Ga0308194_102139992 | 3300031421 | Soil | VPMSDVPHKSERVSGLEAWALALATALIALTAVGVVPHVHW |
| Ga0310888_105217592 | 3300031538 | Soil | RGSVTGASPMSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW |
| Ga0318516_101891962 | 3300031543 | Soil | MSDVPHDSERVSGLEAWALALATALVALIAVGVIPHLHW |
| Ga0318541_100004431 | 3300031545 | Soil | MNDVPHKSERVSGLEAWALALATALVALIAVGVIPHLHW |
| Ga0318528_102660822 | 3300031561 | Soil | MSDVPHDSERVSGLEAWALASATALVALIAVGVIPHLHW |
| Ga0310886_100031094 | 3300031562 | Soil | MGAVPISDLQRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW |
| Ga0310813_100180233 | 3300031716 | Soil | MSDFPHEPERVSQLEAWTLALATALVALIAVGVVPHVHW |
| Ga0318501_106972522 | 3300031736 | Soil | MSDVPHDSERVSGLEAWALALATALVALIAVGVIPHLDW |
| Ga0307468_1011631072 | 3300031740 | Hardwood Forest Soil | MSDFPHESERISGLEAWSLALATALVALIAIGIVPHVHW |
| Ga0307473_109242611 | 3300031820 | Hardwood Forest Soil | MSDFPHESERISGLEAWSLALATALVALIAIGIVPHMHW |
| Ga0310904_100040311 | 3300031854 | Soil | PRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW |
| Ga0318544_100768982 | 3300031880 | Soil | PHDSERVSGLEAWALALATALVALIAVGVIPHLHW |
| Ga0310893_104746412 | 3300031892 | Soil | DFSHEPERISRLEAWALALATALVALIAIGIVPHVHW |
| Ga0310885_106905481 | 3300031943 | Soil | MGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAV |
| Ga0318570_101857231 | 3300032054 | Soil | MSDVPHDSERVSGLEAWALALATALVALIAVGVIPHL |
| Ga0307472_1000967122 | 3300032205 | Hardwood Forest Soil | GMGAAPMCDFPHKSKRVSGLEAWAVALATALVALIAVGVVPHVHW |
| Ga0335085_121332412 | 3300032770 | Soil | MTDFPHEPERVSALEAWARALATALVALIAVGVVPHVHW |
| Ga0335070_107593622 | 3300032829 | Soil | MTDFPHEPERVSGLEAWALAFVTALVALIAIGVVPHVHW |
| Ga0335071_112239692 | 3300032897 | Soil | MTDFPHEPERVSALEAWALALATALVALIAVGVVPHVHW |
| Ga0335084_100666684 | 3300033004 | Soil | MSDFSHEPERISGLEAWALALATALVALIAIGVLPRVHW |
| Ga0326726_102594612 | 3300033433 | Peat Soil | MTDFPHEPERVSGLEAWALALATALVALIAVGVVPHVHW |
| Ga0314868_019534_32_151 | 3300033758 | Peatland | MTDFPHEPERVSGLEAWAQAFVTALVALIAIGVVPHVHW |
| Ga0314870_014588_104_223 | 3300033760 | Peatland | MTDFPHEPKRISRLEAWAFALATTLVALIAIGLVPRVHG |
| Ga0370548_044252_645_764 | 3300034644 | Soil | MSDVPHKSERVSGLEAWALALATALIALTAVGVVPHVHW |
| ⦗Top⦘ |