| Basic Information | |
|---|---|
| Family ID | F029305 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 188 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MFWCVSFHLGAFGTVSLLHETWSKTRQTGAINAKVHAMM |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 188 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 52.94 % |
| % of genes near scaffold ends (potentially truncated) | 7.98 % |
| % of genes from short scaffolds (< 2000 bps) | 9.04 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (47.340 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.447 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (80.319 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 47.34% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 26.60% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 7.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.66% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009971 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_174 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020031 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028147 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028246 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028463 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028465 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070690_1009100981 | 3300005330 | Switchgrass Rhizosphere | MFSSVSFHLGTFGTVSLPHKTQSKTGQTGAINAKVRVNFRNER |
| Ga0070670_1010798831 | 3300005331 | Switchgrass Rhizosphere | STLLDPKLMFWCVSFHLGAFGTVSLLYETWSKMRQTGAINAKV* |
| Ga0070671_1019282873 | 3300005355 | Switchgrass Rhizosphere | MFSCVSFCLGIFWTVSLPHKTQSKTGQTGAINAKVRVNFRNERSRSTPLDP |
| Ga0070686_1002269791 | 3300005544 | Switchgrass Rhizosphere | MFWFVSSHLGAFGTVSLLHETRFKMGQPVAINAKVRATKS |
| Ga0068859_1011316661 | 3300005617 | Switchgrass Rhizosphere | MLPIHILDPKLMFSCVSFHLGAFGTILLPRKTKSKTGHTGAINAKVR* |
| Ga0068859_1012141843 | 3300005617 | Switchgrass Rhizosphere | DPKLMFSCVSFHLGAFGTILLPRKTQSKTGHTGAINAKVR* |
| Ga0068859_1019327711 | 3300005617 | Switchgrass Rhizosphere | VSSRLGPFGTVSLLHETRSKTGQTGAINATVRATMFC* |
| Ga0068863_1027177251 | 3300005841 | Switchgrass Rhizosphere | VSFRSGAFWTVSLLHETWCKTRQTGAINANVHATMSR* |
| Ga0068858_1005272401 | 3300005842 | Switchgrass Rhizosphere | TPLEPKLMFWCDTFHLGAFGTVPLLHETCCKMRQTGAINAKLRDTMSC* |
| Ga0068858_1015644231 | 3300005842 | Switchgrass Rhizosphere | MFWCVSFHLGAFGTVSLQHETWSKTRQTGAINAKVRAMMS |
| Ga0068858_1024504731 | 3300005842 | Switchgrass Rhizosphere | MFWCVSSRLGPFGTVSLLHETRSKMGQTGAINATVRATM |
| Ga0068860_1009293472 | 3300005843 | Switchgrass Rhizosphere | MFWCVSFHLGAFGTVSLLHETTSKTRQNGAINAKVRAMMSS* |
| Ga0068860_1024333321 | 3300005843 | Switchgrass Rhizosphere | MFSCVSFRLCAFGTVSLLHKTRNKTGHTGAINGKVRAMMS |
| Ga0105249_111846211 | 3300009553 | Switchgrass Rhizosphere | PKVMLLCVSFRLGAFGTVSLLHKTCCKTRQTGAINAKV* |
| Ga0105249_123722261 | 3300009553 | Switchgrass Rhizosphere | KLMFWFVSFRLGAFGTVSLLHKTCCKTRQTGAINAKV* |
| Ga0105127_102151 | 3300009971 | Switchgrass Associated | STPLDPKLMFWCISFRLGAFGTVSLLRKTCCKTRQTGAIIAKV* |
| Ga0105128_1218391 | 3300009976 | Switchgrass Associated | MFFCISFRLGAFLTVSLLHETWCKMRQTGAVNVKVRATKPCHNSSQ |
| Ga0105032_1153691 | 3300009979 | Switchgrass Associated | MEPNLMFWCISFRSGAFWTVSQLHETWCKMRQTGAINLKVRATMSCQNFSEQTLLI |
| Ga0105135_1088291 | 3300009980 | Switchgrass Associated | MFWCVSSRLGLFGTVSLLHETRSKTGQTGAINVTVHATMFLLEFFATNVADPLDPKLMFLCI |
| Ga0105133_1155951 | 3300009981 | Switchgrass Associated | MFWYVSFLLGPFGTVLLVHETSCKMSQAGAINAKVRAEMSC |
| Ga0105133_1177231 | 3300009981 | Switchgrass Associated | MFWCVSSRLGLFGTVSLLHETRSKTGQTGAINVTVHATMLLLEFFATNVADPL |
| Ga0105133_1271211 | 3300009981 | Switchgrass Associated | VSSRLGAFGTVSLLHETRTKMGQTNAINAKVHAAMSF* |
| Ga0105029_1236521 | 3300009984 | Switchgrass Rhizosphere | PLAPKLMFWCVSSRLGPFGTISLLHETQSKTGQTGAINATVRATMFC* |
| Ga0105131_1258351 | 3300009989 | Switchgrass Associated | MFWCVSFHLGTFGTVSLQHETWSKTRQTGAINAKVRAM |
| Ga0105120_10143361 | 3300009992 | Switchgrass Associated | MFWCVSFRLGAFGTVSLLHETWCKPRQTGAFNVKVCATKSC |
| Ga0105120_10148621 | 3300009992 | Switchgrass Associated | DTKLMFWCVSSHLGAFGTVSLHHETRTKAGQTDAINAKVHAAMSF* |
| Ga0105120_10306781 | 3300009992 | Switchgrass Associated | VIWCVSFHLGVFGTVSLLHKTRSKTGHTDAINVKVRATMS |
| Ga0105120_10346892 | 3300009992 | Switchgrass Associated | KLMFWCVSSRLGAFGAISLLHETQSNMGQIDAINAKVHAAMSF* |
| Ga0105120_10486731 | 3300009992 | Switchgrass Associated | MFWCVSFRLCAFGTISVLHGTRSKMGQLGAINAGVR |
| Ga0105120_10529401 | 3300009992 | Switchgrass Associated | PKLMFWCVSFRLDPFGTILLLHETWCKTSQAIAINAKVRAAMSS* |
| Ga0105139_10197201 | 3300009995 | Switchgrass Associated | RSTPLDPKLMFWCISFHLGAFGTVSLLHKTRQTGAINTKVRAVMSC* |
| Ga0134127_120407911 | 3300010399 | Terrestrial Soil | PLDPKLMFWFVSFRLGAFGTVSLLHKPCCKTRQTGAINAKV* |
| Ga0134127_133937741 | 3300010399 | Terrestrial Soil | MFSCVSFCLGAFGTFSLPHKTQSKMGQTGAINAKVRATRS |
| Ga0134122_111744111 | 3300010400 | Terrestrial Soil | VFSFHFGAFGTVSLLHETCYKMRQTGAINAKVRAT |
| Ga0163163_104302251 | 3300014325 | Switchgrass Rhizosphere | PKLMFSCVSFRLGTFRTVSLPHKTQSKTGQTGAINAKVRAPMSC* |
| Ga0157379_112161911 | 3300014968 | Switchgrass Rhizosphere | KLMFWCVSFRLGAFGTFSLLHKTCCKARQTGAINAKVRTTMFC* |
| Ga0182100_10152563 | 3300015280 | Switchgrass Phyllosphere | MFSSVSFHLGTFGTVSLPHKTQSKTGQTGAINAKVRVNFRNERSRSTPLDPKHMFWCVPF |
| Ga0182101_10458481 | 3300015284 | Switchgrass Phyllosphere | CVSFRLGPFGTVFLLHETWCKTRQAGAINAKVRAAMSC* |
| Ga0182105_10901881 | 3300015290 | Switchgrass Phyllosphere | MDPKLMFWCISFRSGAFWTVSLLHETWCKTRQTGAINAKV |
| Ga0182103_10092871 | 3300015293 | Switchgrass Phyllosphere | VSFHLGAFGTVLLLHETCRKTRQTGAINAKVRATMSR* |
| Ga0182103_10371252 | 3300015293 | Switchgrass Phyllosphere | MFWCVSFRLGAFVTVSVLHETCRKTCQTGAINAKVRATMSRYNFSQRTLL |
| Ga0182104_10835111 | 3300015297 | Switchgrass Phyllosphere | RSTPLDPKHMFWCVSFRLGAFGTVLQLHETYNKMRQTGAINANVRATKSCQNFSECMLPIHTIGP* |
| Ga0182104_10940292 | 3300015297 | Switchgrass Phyllosphere | MFWCVSFRLGAFWTVSLLHETWSKMRQTGAINTKVHA |
| Ga0182184_10445851 | 3300015301 | Switchgrass Phyllosphere | STPLDPKLMFWCISFRLGAFGTISLLHETRQAGAINAKVRAVMSC* |
| Ga0182180_10496241 | 3300015306 | Switchgrass Phyllosphere | MFWCVSFHLGAFGTVSLQHETWSKTRQTGAINAKVRAM |
| Ga0182098_11007911 | 3300015309 | Switchgrass Phyllosphere | WCVSFHLGAFGTVSLLHETTSKTRQNGAINAKVRAKMSS* |
| Ga0182098_11146141 | 3300015309 | Switchgrass Phyllosphere | MFWCVSFRLGAFVTVSGLHETWGKTRQTGAINVKVRATKSCH |
| Ga0182162_10221921 | 3300015310 | Switchgrass Phyllosphere | VSSRLGPFGTVSLLHETRSKMGQTGAINATVRATMFC* |
| Ga0182168_10635921 | 3300015312 | Switchgrass Phyllosphere | CVSFRLGAFGTVLLLHETWCKTRQTGTINAKVRATMSC* |
| Ga0182168_11243352 | 3300015312 | Switchgrass Phyllosphere | VSFHLGAFGTVSLLHETWSKTRQTGAINAKVNAMMSC* |
| Ga0182168_11373631 | 3300015312 | Switchgrass Phyllosphere | DSKLMFWFVSFRLGAFGTVSLLHKICCKTRQTGAINANV* |
| Ga0182120_10809281 | 3300015315 | Switchgrass Phyllosphere | ISFRSGAFWTVSLLHETWCKTRQTGAINAKVRATMSC* |
| Ga0182120_11131752 | 3300015315 | Switchgrass Phyllosphere | MFSSVSFHLGTFGTVSLPHKTQSKTGQTGAINAKVRVNFRNERSRSTPLDP |
| Ga0182120_11391851 | 3300015315 | Switchgrass Phyllosphere | PKLMFWCVSFRLGAFGTVSLLHKTCYKTRQTGAINAKV* |
| Ga0182181_10856781 | 3300015318 | Switchgrass Phyllosphere | RSGAFWTDSLLHETWCKTRQHGAINAKVRATMSS* |
| Ga0182130_10418531 | 3300015319 | Switchgrass Phyllosphere | LGAFWIVSLLQEAWCKMGRTGAINAKVFATKSHRNFSQQTQLIDPI |
| Ga0182130_10534031 | 3300015319 | Switchgrass Phyllosphere | MFWCVSFHLGAFGTVSLLHETTSKTRQNGAINAKVRA |
| Ga0182130_10611981 | 3300015319 | Switchgrass Phyllosphere | NERSRSTPLDPKLMFWCISFRLGAFGTISLLHETRQSGAINAKVRAVMSC* |
| Ga0182165_10751001 | 3300015320 | Switchgrass Phyllosphere | MFSCVSFSLGAFGTVSLLHKTRSKTGHTGAINAKVRATMSC |
| Ga0182165_10903561 | 3300015320 | Switchgrass Phyllosphere | MFWCVSSRLGPFGTVSLLHETRSKMGQTGAINATVRATMF |
| Ga0182134_11102681 | 3300015324 | Switchgrass Phyllosphere | MFWCVSFRLGAFGTVLLLHETCCKMRQTGTINAKVRATM |
| Ga0182134_11153591 | 3300015324 | Switchgrass Phyllosphere | MFWCVSFRLGAFGTVLQLHETYNKMRQTGAINANVHAT |
| Ga0182134_11327981 | 3300015324 | Switchgrass Phyllosphere | WCVSFHLGAFGTVSLLHETWSKTRQTGAINAKVHAMMSC* |
| Ga0182148_11009311 | 3300015325 | Switchgrass Phyllosphere | MVWCVYFRSGAFWTVSLLHKTCCKTRQTGAINAKVRAMM |
| Ga0182114_10790081 | 3300015327 | Switchgrass Phyllosphere | FVSFRLGAFGTVSLLHETCCKMRQTGTINGKVRATMSC* |
| Ga0182114_10843751 | 3300015327 | Switchgrass Phyllosphere | WCISFRLGAFGTVLLLHETCRKTRQTGAINAKVRATMSS* |
| Ga0182153_10047541 | 3300015328 | Switchgrass Phyllosphere | MFWCLPFHLGAFGTVSLLHETWCKMRQTGAINVKV |
| Ga0182153_10707571 | 3300015328 | Switchgrass Phyllosphere | HLGAFGTVSLLHETWSKTRQTGAINAKVPAVMSC* |
| Ga0182135_10603851 | 3300015329 | Switchgrass Phyllosphere | MFWCVSFRLGEFVTVSLLNETWCKTRQTGAINVKVRAAKSCHNFSQRMLTIHNIG |
| Ga0182135_11005971 | 3300015329 | Switchgrass Phyllosphere | MFSSVSFHLGTFGTVSLPHKTQSKTGQTGAINAKVRVNFR |
| Ga0182135_11119591 | 3300015329 | Switchgrass Phyllosphere | SFYLGAFGTVSLLHETWCKTRQTGAINAKVRAMMSC* |
| Ga0182135_11269791 | 3300015329 | Switchgrass Phyllosphere | CVSFRLGPFGTVFLLHETWCKMRQAGAINAKVRAAISC* |
| Ga0182117_11331391 | 3300015332 | Switchgrass Phyllosphere | VLVRLFPLGAFGIISLMHECQSKTSQTGAINAKVRATKSG* |
| Ga0182147_11140691 | 3300015333 | Switchgrass Phyllosphere | MLWCVSFRLGAFGTVLLLHKNCCKTRQTGAINAKVR |
| Ga0182147_11582431 | 3300015333 | Switchgrass Phyllosphere | MFWCVPFSLGTFGTVLLQHETCYKTCQTGGINAKIRAMMS |
| Ga0182132_10397651 | 3300015334 | Switchgrass Phyllosphere | PLDPKLMFWCVSSRLGPFGTVSLLHETRSKTGQTGAINATVRATMFC* |
| Ga0182132_10444361 | 3300015334 | Switchgrass Phyllosphere | MFWCVSSHLGPFGTVLQLHETRSKTGQTGAINATVRATMFCLNFLQQM |
| Ga0182132_10639881 | 3300015334 | Switchgrass Phyllosphere | CVSFHLGAFGTVSLLHETTSKTRQNGAINAIVRAMMSS* |
| Ga0182116_11298591 | 3300015335 | Switchgrass Phyllosphere | MFWCVSSRLDPFGTVSLLHETRSKTGQTGAINATVRA |
| Ga0182150_10985091 | 3300015336 | Switchgrass Phyllosphere | MFCFVSFRLGAFGTVSLLHETCCKMRQTGTINGKVR |
| Ga0182150_11200611 | 3300015336 | Switchgrass Phyllosphere | MFWCVSFHLGAFGTVLLQHETWCKTRQTGAINAKVCAMMS |
| Ga0182151_10093711 | 3300015337 | Switchgrass Phyllosphere | PKLMFWFVSFRLGAFGTVSLLHKTCCKTRQTGAINAKV* |
| Ga0182151_11254761 | 3300015337 | Switchgrass Phyllosphere | MFWCISFRLGAFGTVSLLHETWCKMRQTGLINAKVHATMS |
| Ga0182151_11322601 | 3300015337 | Switchgrass Phyllosphere | VSFHLGAFGTVSLLHETRSKTRQNGAINTKFRAMMSS* |
| Ga0182151_11613071 | 3300015337 | Switchgrass Phyllosphere | LDPKLMFRCVSSLLGAFGTVSVLHETQSKTGQTDGINAKVHAVMYF* |
| Ga0182137_11162971 | 3300015338 | Switchgrass Phyllosphere | SFRLGTFRTVSLPHKTQSKTGQTGAINAKVRAPMSC* |
| Ga0182137_11174121 | 3300015338 | Switchgrass Phyllosphere | TPLEPKLMFWCISFRLGAFVTISLLLETWCKTRQTGAINVKVRGTKS* |
| Ga0182133_10269031 | 3300015340 | Switchgrass Phyllosphere | LDPKLMFWCVSFRSGAFWTVSLLHETWSKSRQTGAVNAKVHATISR* |
| Ga0182115_11191081 | 3300015348 | Switchgrass Phyllosphere | MFWCDSFRLGAFGTVSPLHETCCKTRQTGAINAKVRATMSCKNFFTTN |
| Ga0182115_11616171 | 3300015348 | Switchgrass Phyllosphere | MFWCVSFRSGAFWTVSLLHEIWCQTRQTGAINAKV |
| Ga0182115_12176311 | 3300015348 | Switchgrass Phyllosphere | MFWCVSFRSGAFWTVSLLHETWSKMRQTGAINTKVH |
| Ga0182115_12517472 | 3300015348 | Switchgrass Phyllosphere | MFSFVSFRLGTFRTVSLPHKTQSKTGQTGAINAKVRAPM |
| Ga0182115_12710831 | 3300015348 | Switchgrass Phyllosphere | HLGAFGTVSLPHKTQSKTGQTGAINAKVRAPMSC* |
| Ga0182185_11536061 | 3300015349 | Switchgrass Phyllosphere | KLMFWCVSSRLGAFGTVSVLHETRSKTGQTDAINAEVRAAMSF* |
| Ga0182169_12074201 | 3300015352 | Switchgrass Phyllosphere | MVWFVSFRLGGFGTVSLLHKTCCKTRQTGAINAKV |
| Ga0182169_12444381 | 3300015352 | Switchgrass Phyllosphere | KLMVWFVSFRLGGFGTVSLLHKTCCKTRQTGAINAKV* |
| Ga0182179_10643351 | 3300015353 | Switchgrass Phyllosphere | LDPKLMFWCISFRLGTFGTVLLLHETCRKTRQTGAINAKVRAVMSC* |
| Ga0182179_12813481 | 3300015353 | Switchgrass Phyllosphere | VSFRLGTFRTVSLPHKTQSKTGQTGAINAKVRAPMSC* |
| Ga0182167_10487921 | 3300015354 | Switchgrass Phyllosphere | MFWYVSFRLGAFGTVSLLHETWCNTRQTGAVNVKVLATK |
| Ga0182167_11710601 | 3300015354 | Switchgrass Phyllosphere | MFWCVSFRLGAFVTVSGLHETWGKTRQTGAINVKVRATK |
| Ga0182167_11877721 | 3300015354 | Switchgrass Phyllosphere | PKLMFWCVSFHLGAFGTVLLLHETWRKTRQTGAIHAKVRATMSR* |
| Ga0182167_11883451 | 3300015354 | Switchgrass Phyllosphere | KLMFWCVSFRSGAFWTVSLLHETWSKTRQTGAINAKVHAMMSS* |
| Ga0182167_12214701 | 3300015354 | Switchgrass Phyllosphere | HLDFKLMFWCVSFRLGAFGTVSLLHETWCKMRQTGAINAKVHATMSR* |
| Ga0182167_12624132 | 3300015354 | Switchgrass Phyllosphere | MFWRVPFRLGAFGTVSLLHETCCKTRQTGAINAKARAT |
| Ga0182201_10622801 | 3300017422 | Switchgrass Phyllosphere | MFSFVSFRLGTFRTVSLPHKTQSKTGQTGAINAKVR |
| Ga0182201_11265272 | 3300017422 | Switchgrass Phyllosphere | MPLDPKLMFWCVSSRLGAFGTVSVLHETRSKTGQTDAIN |
| Ga0182201_11277111 | 3300017422 | Switchgrass Phyllosphere | MFWCVSFHLGAFGTVSLQHETWSKTRQTGAINAKVRA |
| Ga0182194_11098711 | 3300017435 | Switchgrass Phyllosphere | MFWCVYFRLGAFGTISLLHETCCKTRQTGTINAKVRATISC |
| Ga0182194_11196521 | 3300017435 | Switchgrass Phyllosphere | PKLMLWGVSFRLGSFGTVSLLHKTCCKTRQTGAINAKV |
| Ga0182194_11296661 | 3300017435 | Switchgrass Phyllosphere | GAFVTISLLPETWCKTRQTGAINVKVRATKLCHNFSQ |
| Ga0182198_10193121 | 3300017445 | Switchgrass Phyllosphere | MFWHVSYCLGVFGTISSPYETQFKTAQTGAINAKVRATNLRR |
| Ga0182198_10379781 | 3300017445 | Switchgrass Phyllosphere | MFWCVSFHLGAFGTVSLLHETWCKSRQTGAINVKVRATKSCH |
| Ga0182198_11885561 | 3300017445 | Switchgrass Phyllosphere | MFSCVSFHLGAFGTVSLLHKTRSKTGHTGAINAKVRAQ |
| Ga0182198_11923611 | 3300017445 | Switchgrass Phyllosphere | MFWCVSFRLGAFGTVLLLHETYNKMRQTGAINANVRATKSCQN |
| Ga0182216_10498841 | 3300017693 | Switchgrass Phyllosphere | MFWCVSFRLGAFGTVSLLHKTCCKTRQTGAINAKV |
| Ga0182216_11574071 | 3300017693 | Switchgrass Phyllosphere | MFWCVSFRLGAFGTVSLLHKTCCKTRQTGAINAKVRAM |
| Ga0182178_10020411 | 3300020023 | Switchgrass Phyllosphere | CVSFRLGTFRTVSLPHKTQSKTGQTGAINAKVRAPMSC |
| Ga0182119_1005481 | 3300020031 | Switchgrass Phyllosphere | SFRLGPFGTVFLLHETWCKTRQAGAINAKVRAAMSC |
| Ga0182119_1027771 | 3300020031 | Switchgrass Phyllosphere | LMFWCVSSRLGPFGTVSLLHETRSKTGQTGAINATVRATMFC |
| Ga0182119_1042041 | 3300020031 | Switchgrass Phyllosphere | MPLDPKLMFWCVSSSLGALGTISVLHETRSKTVQIEAINAKVHA |
| Ga0182118_1058561 | 3300020223 | Switchgrass Phyllosphere | MFWYDSFRLGAFGTVSLLYETWCKTRQTGAINAKVRATMSCRNFS |
| Ga0207653_101874841 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MFWCVSSRLGPFGTVSLLHETRSKTGQTGAINATVRATM |
| Ga0207710_103479082 | 3300025900 | Switchgrass Rhizosphere | MFWCVSFHLGAFGTVSLLHETTSKTRQNGAINAKVRAMMSS |
| Ga0207646_113749551 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MFWCVSSRLGPFGTVSLLHETRSKMGQTGAINATV |
| Ga0207650_110589811 | 3300025925 | Switchgrass Rhizosphere | TLLDPKLMFWCVSFHLGAFGTVSLLYETWSKMRQTGAINAKV |
| Ga0207650_117777731 | 3300025925 | Switchgrass Rhizosphere | MFSCVSFRLGAFGTVSLLHKTRNKTGHTGAVNGKVR |
| Ga0207644_107087101 | 3300025931 | Switchgrass Rhizosphere | CVSSRLGPFGTVSLLHETRSKMGQTGAINATVRATMFC |
| Ga0207670_110506321 | 3300025936 | Switchgrass Rhizosphere | FYLGAFGTVSLLHETWCKTRQTGAINAKVRAMMSC |
| Ga0207712_116018791 | 3300025961 | Switchgrass Rhizosphere | FPFGAFGTVSLLHKTCWKTRQTGAINAKVLAMMSS |
| Ga0207703_102349291 | 3300026035 | Switchgrass Rhizosphere | LMFWCVSSHLGPFGTVLQLHETRSKTGQTGAINATVRATMFCLNFLQQMLLIHTIGP |
| Ga0207703_123780141 | 3300026035 | Switchgrass Rhizosphere | MFWCVSSHLGPFGTVLQLHETRSKTGQTGAINATVRATMFYLNFLQQMLLIHTIG |
| Ga0207675_1011411392 | 3300026118 | Switchgrass Rhizosphere | MFWCVSSRLGPFGTVSLLHETRSKTGQTGAINATVRATMF |
| Ga0207675_1018927911 | 3300026118 | Switchgrass Rhizosphere | MFWCVSSRLGPFGTVSLLHETRSKMGQTGAINETVR |
| Ga0268328_10213701 | 3300028050 | Phyllosphere | MFSCVSFRLGAFGTVSLLHKTRNKTGHTGAVNGKVRATMSC |
| Ga0268328_10335161 | 3300028050 | Phyllosphere | MFSSVSFHLGTFGTVSLPHKTQSKTGQTGAINSKVRAT |
| Ga0268328_10423871 | 3300028050 | Phyllosphere | MFWCVSFRLGAFVTVSVLHETCLKTCQTGAINAKVRATV |
| Ga0268306_10029171 | 3300028054 | Phyllosphere | MPLDPKLMFWCVSSSLGALGTISVLHETRSKTVQIEAI |
| Ga0268306_10227242 | 3300028054 | Phyllosphere | MFWCVSSRLGPFGTVSLLHETRSKTGQTDAINAKVHA |
| Ga0268338_10006441 | 3300028055 | Phyllosphere | SRLGPIWTVSLLHETRSKTGQTGAINATVRATMFC |
| Ga0268338_10010003 | 3300028055 | Phyllosphere | MFWCVSFRLGAFWTVSLLHETWSKMRQTGAINTKVHATMS |
| Ga0268338_10062061 | 3300028055 | Phyllosphere | MFWCVSFHLGAFGTVSLLHETWSKTHQTGAINAKVRAMMSSWNFCNESS |
| Ga0268330_10406311 | 3300028056 | Phyllosphere | MFWRVSFRLGAFGTVSSPYETWLKTGRTSTIKAKVRATKSVQNFSQRMHLIHPIGP |
| Ga0268332_10220021 | 3300028058 | Phyllosphere | MFWCVSFHLGAFGTVSLQHETWSKTRQTGAINAKVRAMMSS |
| Ga0268314_10303561 | 3300028061 | Phyllosphere | AFHLGAFGTVSLLHETWCKMRQTGAINVKVRATKSCYNFSQ |
| Ga0268314_10494731 | 3300028061 | Phyllosphere | MFLCSSFRSRAFGTVLLLHETCCKTRQTGAINAKVHAT |
| Ga0268342_10154531 | 3300028062 | Phyllosphere | MVWFVSFRLGGFGTVSLLHKTCCKTRQTGAINAKVRATMS |
| Ga0268326_10051711 | 3300028141 | Phyllosphere | MDPKLMFWCISFRSGAFWTVSLLHETWCKTRQTGAINAKVRATMS |
| Ga0268347_10018231 | 3300028142 | Phyllosphere | SFRLGTFRTVSLPHKTQSKTGQTGAINAKVRAPMSC |
| Ga0268347_10133371 | 3300028142 | Phyllosphere | MFSSVSFHLGTFGTVSLPHKTQSKTGQTGAINAKVRV |
| Ga0268348_10065681 | 3300028143 | Phyllosphere | MFWCVSFHLGAFGTVSLQHETWSKTRQTGAINAKV |
| Ga0268345_10165231 | 3300028144 | Phyllosphere | MPLDPKLMFWCVSSSLGAFGTISVLHETRSKTVQIEAINAKVHAAMS |
| Ga0268345_10224691 | 3300028144 | Phyllosphere | PLDPKLMFWCVSSRLGAFGTISVLHETRSKTVQIEAINAKVHAAMSF |
| Ga0268303_1007111 | 3300028147 | Phyllosphere | MFSSVSFHLGTFGTVSLPHKTQSKTGQTGAINAKVRVNFRNERARST |
| Ga0268303_1014371 | 3300028147 | Phyllosphere | KLMFWCVSFRLGAFGTVSLLHETWCKMRQTGAINAKVHATMSR |
| Ga0268343_10164881 | 3300028150 | Phyllosphere | MFWCVSSRLGPFGTVSLLHETRSKMGQTGAINATVRATMFC |
| Ga0268308_10012591 | 3300028151 | Phyllosphere | MFWCVSSHLGPFGTVSLLHETRSKTGQTGAINATVRATMFCE |
| Ga0268308_10084281 | 3300028151 | Phyllosphere | LDPKLMFWGIFFHLGAFGTVSQLYETCFKTRQIGAINAKVSATMSC |
| Ga0268308_10093671 | 3300028151 | Phyllosphere | LMLWCVSFRLGAFWTVSLLHETWSKMRQTGAINTKVHATMSC |
| Ga0268336_10049321 | 3300028152 | Phyllosphere | MFWCVSFHLGAFGTVSLLHETWSKTRQTGAINAKVRAMMSSWNFC |
| Ga0268320_10001393 | 3300028153 | Phyllosphere | TPFEPKLMFWCVSFYLGAFGTVSLLHETWCKTRQTGAINAKVRAMMSC |
| Ga0268320_10243962 | 3300028153 | Phyllosphere | VSFRLGPFGTVFLLHETWCKTRQAGAINAKVRAAMSC |
| Ga0268351_10123631 | 3300028246 | Phyllosphere | SRLGPFGTVSLLHETRSKTGQTGAINATVRATMFC |
| Ga0268312_10374121 | 3300028248 | Phyllosphere | MFWCVSFHLGAFGTVSLLHETWSKTRQTGAINAKVHAMM |
| Ga0268324_10003231 | 3300028251 | Phyllosphere | HMFWYISSRLGPFGTVSLLHETRSKTGQTGAINATVRATMFCLNFSQQMLPIHTIGP |
| Ga0268324_10186241 | 3300028251 | Phyllosphere | MFSCVSFHLGAFGAVSLPHKTQSKTGQTGAINAKVRAMMSFLEF |
| Ga0268316_10015991 | 3300028253 | Phyllosphere | FVSFRLGGFGTVSLLHKTCCKTRQTGAINAKVRATMSC |
| Ga0268304_10029331 | 3300028256 | Phyllosphere | MFWCVSFHLGTFGTVSLQHETWSKTRQTGAINAKVRA |
| Ga0268304_10091921 | 3300028256 | Phyllosphere | MFWCVSSSLGALGTISVLHETRSKTVQIEAINAKVHAAM |
| Ga0268264_112674641 | 3300028381 | Switchgrass Rhizosphere | MFWCVSFRLGAFVTVSLLHETWCKTRQTGAINVKVCATKSCHYFL |
| Ga0268325_1032481 | 3300028463 | Phyllosphere | MFRCVSSLLGAFGTVSVLHETRSKTGQTDAINAKVHAVMSF |
| Ga0268301_1014841 | 3300028465 | Phyllosphere | MFWCVSSRLGPFGTVSLLHETRSKTGQTGAINATVRA |
| Ga0268321_1001131 | 3300028466 | Phyllosphere | MFWCVSSHLGPFGTVLQLHETRSKTGQTGAINATVRATMFCLNFLQQMLLIHTIGP |
| Ga0268333_10002281 | 3300028467 | Phyllosphere | MFWCVSFHLGAFGTVSLLHETWSKTRHTGAINAKVHAMMS |
| Ga0268317_10055942 | 3300028468 | Phyllosphere | MFWCVSSHLGPFGTVLQLHETRSKTGQTGAINATVRATM |
| Ga0268315_10269322 | 3300028472 | Phyllosphere | MFWCVSFRSGAFWTVSLLHETWSKMRQTGAINAKVRAMMSF |
| Ga0268327_10081341 | 3300028475 | Phyllosphere | MFSSVSFYWGTFGTVSLPHKTQSKTGQTGVINSKVRA |
| Ga0268327_10142751 | 3300028475 | Phyllosphere | VWCVSFRSGAFWTVSLLHETWSKMRQTGAINAKVRATMSC |
| Ga0268329_10171411 | 3300028476 | Phyllosphere | MFGCFAFHLGAFGTVSLLHETWCKMRQTGAINVKVRATKSC |
| Ga0268313_10030601 | 3300028523 | Phyllosphere | VSSRLGPFGTVSLLHETRSKTGQTGAINATVRATMFC |
| Ga0268313_10120821 | 3300028523 | Phyllosphere | MFWCVSFRSGAFWTVSLLHETWSKTRQTGAINAKVHAM |
| Ga0268313_10181231 | 3300028523 | Phyllosphere | MFWCVSSHLGPFGTVLQLHETRSKTGQTGAINATVRATMFYLNFLQQMLLIHT |
| Ga0268305_1006051 | 3300028525 | Phyllosphere | MFSSVSFHLGTFGTVSLPHKTQSKTGQTGAINAKVRVNFRNERS |
| Ga0268305_1064161 | 3300028525 | Phyllosphere | CVSFRLGPFGTVFLLHETWCKTRQAGAINAKVRAAMSC |
| Ga0268339_10033381 | 3300028526 | Phyllosphere | STLLDPKLMFWCVSFYLGAFGTVSLLYETWSKTRQTGAINAKV |
| Ga0214503_12940631 | 3300032466 | Switchgrass Phyllosphere | MFWFVSFRLGAFGTVSLLHKTCCKTRQTGAINAKV |
| Ga0214495_10758441 | 3300032490 | Switchgrass Phyllosphere | MFWCVSSRFGPFGTVSLLHETQSKTGQTGAINAIVRATMFCLNFLQ |
| Ga0214497_10805901 | 3300032689 | Switchgrass Phyllosphere | GVSSRLGPFGTVSLLHKTRSKTGQTGAINATVRATMFC |
| Ga0314757_11114711 | 3300033534 | Switchgrass Phyllosphere | MFWCVSSRLGPFGTVSLLHETRSKTGQTGAINATVRATMFCLNFLQQM |
| ⦗Top⦘ |