Basic Information | |
---|---|
Family ID | F027877 |
Family Type | Metagenome |
Number of Sequences | 193 |
Average Sequence Length | 45 residues |
Representative Sequence | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGY |
Number of Associated Samples | 141 |
Number of Associated Scaffolds | 193 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 52.36 % |
% of genes near scaffold ends (potentially truncated) | 74.09 % |
% of genes from short scaffolds (< 2000 bps) | 83.42 % |
Associated GOLD sequencing projects | 131 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (56.995 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (19.689 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.197 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.404 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 193 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 4.15 |
PF10908 | DUF2778 | 2.59 |
PF02586 | SRAP | 2.07 |
PF04828 | GFA | 1.55 |
PF03061 | 4HBT | 1.04 |
PF13531 | SBP_bac_11 | 1.04 |
PF08352 | oligo_HPY | 1.04 |
PF08448 | PAS_4 | 1.04 |
PF13545 | HTH_Crp_2 | 1.04 |
PF13185 | GAF_2 | 0.52 |
PF00561 | Abhydrolase_1 | 0.52 |
PF11003 | DUF2842 | 0.52 |
PF02656 | DUF202 | 0.52 |
PF03631 | Virul_fac_BrkB | 0.52 |
PF13641 | Glyco_tranf_2_3 | 0.52 |
PF14023 | DUF4239 | 0.52 |
PF13683 | rve_3 | 0.52 |
PF09851 | SHOCT | 0.52 |
PF12697 | Abhydrolase_6 | 0.52 |
PF07690 | MFS_1 | 0.52 |
PF00291 | PALP | 0.52 |
PF14087 | DUF4267 | 0.52 |
PF07366 | SnoaL | 0.52 |
PF00565 | SNase | 0.52 |
PF12833 | HTH_18 | 0.52 |
PF07411 | DUF1508 | 0.52 |
PF00072 | Response_reg | 0.52 |
PF13458 | Peripla_BP_6 | 0.52 |
PF17191 | RecG_wedge | 0.52 |
PF11752 | DUF3309 | 0.52 |
PF06186 | DUF992 | 0.52 |
PF00496 | SBP_bac_5 | 0.52 |
PF00816 | Histone_HNS | 0.52 |
PF06742 | DUF1214 | 0.52 |
PF00248 | Aldo_ket_red | 0.52 |
PF16868 | NMT1_3 | 0.52 |
PF07992 | Pyr_redox_2 | 0.52 |
PF13396 | PLDc_N | 0.52 |
PF02371 | Transposase_20 | 0.52 |
PF02628 | COX15-CtaA | 0.52 |
PF00378 | ECH_1 | 0.52 |
PF09361 | Phasin_2 | 0.52 |
COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 4.15 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 2.07 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.55 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.52 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.52 |
COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.52 |
COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.52 |
COG3422 | Uncharacterized conserved protein YegP, UPF0339 family | Function unknown [S] | 0.52 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.52 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.52 |
COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 56.99 % |
Unclassified | root | N/A | 43.01 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309004|prs_FHA1B5K04X76I4 | Not Available | 514 | Open in IMG/M |
2088090015|GPICI_9039568 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 1704 | Open in IMG/M |
2140918007|ConsensusfromContig85399 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 836 | Open in IMG/M |
2170459008|GA8OVOZ01BGR5I | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 500 | Open in IMG/M |
2170459017|G14TP7Y02IYQQF | Not Available | 720 | Open in IMG/M |
2170459023|GZGNO2B01EV1GZ | Not Available | 504 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101759790 | Not Available | 540 | Open in IMG/M |
3300000550|F24TB_11955065 | Not Available | 561 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1003471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2555 | Open in IMG/M |
3300000690|JGI12582J11924_102698 | Not Available | 515 | Open in IMG/M |
3300000702|JGI12537J11925_102081 | Not Available | 804 | Open in IMG/M |
3300000721|JGI12410J11868_104371 | Not Available | 545 | Open in IMG/M |
3300000731|JGI12381J11899_1014592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 631 | Open in IMG/M |
3300001213|JGIcombinedJ13530_100609747 | Not Available | 510 | Open in IMG/M |
3300003911|JGI25405J52794_10029138 | Not Available | 1142 | Open in IMG/M |
3300004091|Ga0062387_101252113 | Not Available | 583 | Open in IMG/M |
3300004479|Ga0062595_100654345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 832 | Open in IMG/M |
3300004633|Ga0066395_10244860 | Not Available | 959 | Open in IMG/M |
3300005093|Ga0062594_100226368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1338 | Open in IMG/M |
3300005332|Ga0066388_100295757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2263 | Open in IMG/M |
3300005332|Ga0066388_100848207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1499 | Open in IMG/M |
3300005332|Ga0066388_101889579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1065 | Open in IMG/M |
3300005332|Ga0066388_107546229 | Not Available | 545 | Open in IMG/M |
3300005364|Ga0070673_100614493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 992 | Open in IMG/M |
3300005439|Ga0070711_100168749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1666 | Open in IMG/M |
3300005466|Ga0070685_10979662 | Not Available | 633 | Open in IMG/M |
3300005545|Ga0070695_100267277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
3300005618|Ga0068864_100083531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2805 | Open in IMG/M |
3300005713|Ga0066905_100352585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1176 | Open in IMG/M |
3300005764|Ga0066903_101193231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1412 | Open in IMG/M |
3300005764|Ga0066903_106573553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 605 | Open in IMG/M |
3300005764|Ga0066903_108445899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 525 | Open in IMG/M |
3300005937|Ga0081455_10009145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10217 | Open in IMG/M |
3300005937|Ga0081455_10049179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3637 | Open in IMG/M |
3300005983|Ga0081540_1048657 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
3300006049|Ga0075417_10223577 | Not Available | 897 | Open in IMG/M |
3300006049|Ga0075417_10267459 | Not Available | 823 | Open in IMG/M |
3300006049|Ga0075417_10295207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 785 | Open in IMG/M |
3300006237|Ga0097621_100707039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas → Dehalogenimonas formicexedens | 928 | Open in IMG/M |
3300006845|Ga0075421_100562086 | Not Available | 1346 | Open in IMG/M |
3300006846|Ga0075430_101530514 | Not Available | 548 | Open in IMG/M |
3300006854|Ga0075425_100177611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2445 | Open in IMG/M |
3300006854|Ga0075425_102222894 | Not Available | 611 | Open in IMG/M |
3300006871|Ga0075434_100300594 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
3300006880|Ga0075429_101192802 | Not Available | 664 | Open in IMG/M |
3300006904|Ga0075424_101455007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 727 | Open in IMG/M |
3300006954|Ga0079219_10168497 | Not Available | 1196 | Open in IMG/M |
3300006969|Ga0075419_10684096 | Not Available | 726 | Open in IMG/M |
3300007076|Ga0075435_100182978 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300009011|Ga0105251_10135278 | Not Available | 1116 | Open in IMG/M |
3300009094|Ga0111539_11113284 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300009147|Ga0114129_10274102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2256 | Open in IMG/M |
3300009147|Ga0114129_10359841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BIWAKO-01 | 1926 | Open in IMG/M |
3300009147|Ga0114129_10469763 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
3300009147|Ga0114129_12008819 | Not Available | 699 | Open in IMG/M |
3300009147|Ga0114129_12927102 | Not Available | 564 | Open in IMG/M |
3300009156|Ga0111538_10125539 | Not Available | 3259 | Open in IMG/M |
3300009162|Ga0075423_10750350 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 1032 | Open in IMG/M |
3300009162|Ga0075423_11961152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 633 | Open in IMG/M |
3300009162|Ga0075423_12187336 | Not Available | 601 | Open in IMG/M |
3300009168|Ga0105104_10139276 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 1311 | Open in IMG/M |
3300009506|Ga0118657_11941972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 681 | Open in IMG/M |
3300009506|Ga0118657_12221482 | Not Available | 628 | Open in IMG/M |
3300009792|Ga0126374_10051577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2091 | Open in IMG/M |
3300009792|Ga0126374_11019926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 650 | Open in IMG/M |
3300009792|Ga0126374_11142899 | Not Available | 620 | Open in IMG/M |
3300010043|Ga0126380_10025172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2928 | Open in IMG/M |
3300010043|Ga0126380_10966848 | Not Available | 714 | Open in IMG/M |
3300010046|Ga0126384_10014021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5060 | Open in IMG/M |
3300010046|Ga0126384_10436470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1114 | Open in IMG/M |
3300010046|Ga0126384_11189938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
3300010046|Ga0126384_11343966 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300010046|Ga0126384_11553628 | Not Available | 622 | Open in IMG/M |
3300010046|Ga0126384_11718177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
3300010046|Ga0126384_12120076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 540 | Open in IMG/M |
3300010046|Ga0126384_12249339 | Not Available | 525 | Open in IMG/M |
3300010047|Ga0126382_12394637 | Not Available | 512 | Open in IMG/M |
3300010048|Ga0126373_10185963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2003 | Open in IMG/M |
3300010358|Ga0126370_10205416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1492 | Open in IMG/M |
3300010359|Ga0126376_13119194 | Not Available | 513 | Open in IMG/M |
3300010360|Ga0126372_12694965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
3300010361|Ga0126378_10207723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 2037 | Open in IMG/M |
3300010362|Ga0126377_10098375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2664 | Open in IMG/M |
3300010362|Ga0126377_12297140 | Not Available | 615 | Open in IMG/M |
3300010863|Ga0124850_1051079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1295 | Open in IMG/M |
3300012948|Ga0126375_10132838 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
3300012948|Ga0126375_10476626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 924 | Open in IMG/M |
3300012948|Ga0126375_11577810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 564 | Open in IMG/M |
3300012951|Ga0164300_10288023 | Not Available | 853 | Open in IMG/M |
3300012955|Ga0164298_10446637 | Not Available | 849 | Open in IMG/M |
3300012961|Ga0164302_11049365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 639 | Open in IMG/M |
3300012984|Ga0164309_10386766 | Not Available | 1039 | Open in IMG/M |
3300012984|Ga0164309_11799579 | Not Available | 525 | Open in IMG/M |
3300012987|Ga0164307_11606175 | Not Available | 550 | Open in IMG/M |
3300013105|Ga0157369_10830850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 949 | Open in IMG/M |
3300013297|Ga0157378_10708522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1026 | Open in IMG/M |
3300013306|Ga0163162_13309310 | Not Available | 516 | Open in IMG/M |
3300014745|Ga0157377_11283028 | Not Available | 571 | Open in IMG/M |
3300014968|Ga0157379_12515940 | Not Available | 515 | Open in IMG/M |
3300015371|Ga0132258_10225152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4566 | Open in IMG/M |
3300015371|Ga0132258_12221277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1377 | Open in IMG/M |
3300015372|Ga0132256_101793006 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300015372|Ga0132256_102974732 | Not Available | 570 | Open in IMG/M |
3300015373|Ga0132257_102607083 | Not Available | 657 | Open in IMG/M |
3300015373|Ga0132257_103404564 | Not Available | 579 | Open in IMG/M |
3300015373|Ga0132257_103432926 | Not Available | 577 | Open in IMG/M |
3300015374|Ga0132255_103022459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
3300016270|Ga0182036_11369757 | Not Available | 592 | Open in IMG/M |
3300016341|Ga0182035_10000658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 16349 | Open in IMG/M |
3300016357|Ga0182032_10224637 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300016357|Ga0182032_10547480 | Not Available | 957 | Open in IMG/M |
3300016371|Ga0182034_10000132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 31058 | Open in IMG/M |
3300017974|Ga0187777_10237776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1234 | Open in IMG/M |
3300017994|Ga0187822_10136246 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300018028|Ga0184608_10129876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1074 | Open in IMG/M |
3300018054|Ga0184621_10123395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 927 | Open in IMG/M |
3300021344|Ga0193719_10246196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 757 | Open in IMG/M |
3300021560|Ga0126371_10333040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1650 | Open in IMG/M |
3300021560|Ga0126371_12473073 | Not Available | 628 | Open in IMG/M |
3300025898|Ga0207692_10887538 | Not Available | 586 | Open in IMG/M |
3300025916|Ga0207663_10474893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 968 | Open in IMG/M |
3300025925|Ga0207650_10614500 | Not Available | 915 | Open in IMG/M |
3300026294|Ga0209839_10289064 | Not Available | 505 | Open in IMG/M |
3300026800|Ga0207742_101334 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
3300026810|Ga0207801_100668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2598 | Open in IMG/M |
3300026855|Ga0208404_1006918 | Not Available | 501 | Open in IMG/M |
3300026860|Ga0207823_104925 | Not Available | 1051 | Open in IMG/M |
3300026869|Ga0207821_1018478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 697 | Open in IMG/M |
3300026869|Ga0207821_1020485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 655 | Open in IMG/M |
3300026889|Ga0207745_1002744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 2041 | Open in IMG/M |
3300026896|Ga0207730_1013466 | Not Available | 698 | Open in IMG/M |
3300026909|Ga0207858_1010461 | Not Available | 918 | Open in IMG/M |
3300026953|Ga0207835_1021461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS188 | 829 | Open in IMG/M |
3300027010|Ga0207839_1003426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2065 | Open in IMG/M |
3300027010|Ga0207839_1025870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 666 | Open in IMG/M |
3300027011|Ga0207740_1005249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2079 | Open in IMG/M |
3300027011|Ga0207740_1029057 | Not Available | 685 | Open in IMG/M |
3300027039|Ga0207855_1051718 | Not Available | 555 | Open in IMG/M |
3300027045|Ga0207726_1009705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1658 | Open in IMG/M |
3300027313|Ga0207780_1025983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1062 | Open in IMG/M |
3300027313|Ga0207780_1076275 | Not Available | 564 | Open in IMG/M |
3300027516|Ga0207761_1089291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 600 | Open in IMG/M |
3300027680|Ga0207826_1155694 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300027680|Ga0207826_1192591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 551 | Open in IMG/M |
3300027703|Ga0207862_1114979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
3300027703|Ga0207862_1252152 | Not Available | 517 | Open in IMG/M |
3300027873|Ga0209814_10165308 | Not Available | 951 | Open in IMG/M |
3300027873|Ga0209814_10536109 | Not Available | 520 | Open in IMG/M |
3300027874|Ga0209465_10033671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2419 | Open in IMG/M |
3300028719|Ga0307301_10318762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 510 | Open in IMG/M |
3300028784|Ga0307282_10420975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 647 | Open in IMG/M |
3300028819|Ga0307296_10221244 | Not Available | 1028 | Open in IMG/M |
3300028878|Ga0307278_10465870 | Not Available | 553 | Open in IMG/M |
3300031226|Ga0307497_10030482 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1753 | Open in IMG/M |
3300031226|Ga0307497_10154223 | Not Available | 956 | Open in IMG/M |
3300031226|Ga0307497_10318676 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300031231|Ga0170824_112083508 | Not Available | 505 | Open in IMG/M |
3300031446|Ga0170820_12321242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. AR10 | 540 | Open in IMG/M |
3300031446|Ga0170820_15285200 | Not Available | 620 | Open in IMG/M |
3300031469|Ga0170819_12779972 | Not Available | 1091 | Open in IMG/M |
3300031543|Ga0318516_10210520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1124 | Open in IMG/M |
3300031544|Ga0318534_10361840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 835 | Open in IMG/M |
3300031573|Ga0310915_10070557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 2301 | Open in IMG/M |
3300031573|Ga0310915_11277776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 506 | Open in IMG/M |
3300031763|Ga0318537_10176685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 795 | Open in IMG/M |
3300031779|Ga0318566_10399696 | Not Available | 676 | Open in IMG/M |
3300031795|Ga0318557_10607532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
3300031797|Ga0318550_10090635 | Not Available | 1431 | Open in IMG/M |
3300031819|Ga0318568_10609770 | Not Available | 680 | Open in IMG/M |
3300031897|Ga0318520_10590824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 690 | Open in IMG/M |
3300031908|Ga0310900_11261331 | Not Available | 617 | Open in IMG/M |
3300031910|Ga0306923_11665910 | Not Available | 660 | Open in IMG/M |
3300031912|Ga0306921_11363951 | Not Available | 781 | Open in IMG/M |
3300031912|Ga0306921_11570396 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300031941|Ga0310912_11335779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 543 | Open in IMG/M |
3300031943|Ga0310885_10398026 | Not Available | 733 | Open in IMG/M |
3300031944|Ga0310884_10851228 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300031945|Ga0310913_10000890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 14634 | Open in IMG/M |
3300031945|Ga0310913_10003016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9156 | Open in IMG/M |
3300031946|Ga0310910_11538370 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300031947|Ga0310909_11120000 | Not Available | 639 | Open in IMG/M |
3300031954|Ga0306926_12993028 | Not Available | 505 | Open in IMG/M |
3300032001|Ga0306922_10033469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5245 | Open in IMG/M |
3300032001|Ga0306922_10055626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4103 | Open in IMG/M |
3300032042|Ga0318545_10080502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1128 | Open in IMG/M |
3300032076|Ga0306924_10002448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 17514 | Open in IMG/M |
3300032076|Ga0306924_11445940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 731 | Open in IMG/M |
3300032094|Ga0318540_10243670 | Not Available | 868 | Open in IMG/M |
3300032261|Ga0306920_103127423 | Not Available | 621 | Open in IMG/M |
3300034090|Ga0326723_0145858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1038 | Open in IMG/M |
3300034819|Ga0373958_0056838 | Not Available | 839 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 19.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.47% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.77% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.11% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.07% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.55% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 1.04% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.04% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.04% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.52% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.52% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.52% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.52% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.52% |
Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.52% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.52% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.52% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.52% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
2170459008 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000690 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 | Environmental | Open in IMG/M |
3300000702 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 | Environmental | Open in IMG/M |
3300000721 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 | Environmental | Open in IMG/M |
3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026800 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes) | Environmental | Open in IMG/M |
3300026810 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 (SPAdes) | Environmental | Open in IMG/M |
3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
3300026855 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA (SPAdes) | Environmental | Open in IMG/M |
3300026860 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes) | Environmental | Open in IMG/M |
3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
3300026889 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes) | Environmental | Open in IMG/M |
3300026896 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes) | Environmental | Open in IMG/M |
3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
3300026953 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes) | Environmental | Open in IMG/M |
3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
prs_00577870 | 2070309004 | Green-Waste Compost | MGCNARNDEIHENLERMRGEREAYEDALVIVRQFNARLSANRPRFMW |
GPICI_01181170 | 2088090015 | Soil | MGYNARNDEIRDNVTRMRDEWDAQRGALATVRRFNATLSAKGYVWFWPKIAAAL |
A_all_C_01178320 | 2140918007 | Soil | MGYNARNDDIHDNIVRMQRDWEAQRDALATVRRFNARLSAK |
F48_06625460 | 2170459008 | Grass Soil | MPERYHRPRNDEIRDNIERTQQAWKAHKDALATVRRFNARLSVKRAAWFWPKIAA |
4ZMR_04917810 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MGYNARNDEIRDNVARMRREWEAQHGALATVRRFNATL |
FA3_02774920 | 2170459023 | Grass Soil | MGYNARNDEIRDNITRMRREWEAQRNALATVRRFNATLFAKGYVW |
INPhiseqgaiiFebDRAFT_1017597902 | 3300000364 | Soil | MGYNARNDEIRDNVTRMRRXWEAQRGXXATXRRFNASA* |
F24TB_119550651 | 3300000550 | Soil | MGHNARNDEIRDNVTRMRREWEAQRGALATVRRFNAILSA |
AF_2010_repII_A01DRAFT_10034714 | 3300000580 | Forest Soil | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFSAALSAKGYVWF* |
JGI12582J11924_1026981 | 3300000690 | Tropical Forest Soil | MGYNARNDEIHENVERMRREREAYEDSLAIVRQFNARLSAKKTA |
JGI12537J11925_1020811 | 3300000702 | Tropical Forest Soil | MGYNARNDEIHENVERMRREREAYEDSLAIVRQFNARLSAKRPHGSGRQ* |
JGI12410J11868_1043711 | 3300000721 | Tropical Forest Soil | MGYNARNDEIHENVERMRREREAYEDSLAIVRQFN |
JGI12381J11899_10145921 | 3300000731 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREDYEDSLAIVRQFNARLS |
JGIcombinedJ13530_1006097472 | 3300001213 | Wetland | MGYNARNDEIRDNITRMRREWEAERDALATVRRFN |
JGI25405J52794_100291382 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MGYNARNDEIRDNVARMQRECEAQRSALATVRRFNAALSAKGDVWF |
Ga0062387_1012521131 | 3300004091 | Bog Forest Soil | MGYNARNDEIQDNIARMQREWEAQRDALATVRQFNARLAAKGYVWFWPKIAAAI |
Ga0062595_1006543453 | 3300004479 | Soil | MGYNARNDEIRDNITRMKREWEAQRDALATVRRFNARLSAKGYSWF |
Ga0066395_102448601 | 3300004633 | Tropical Forest Soil | MGYSARNDEIRDNITRMRREWEAQRGATLATVRRFNAFG* |
Ga0062594_1002263681 | 3300005093 | Soil | MGYNARNDEIRDNITRMRRDWEEERDALAAVRRFNAKLSAKGYSWSWPKIAAALKS |
Ga0066388_1002957575 | 3300005332 | Tropical Forest Soil | MGYNARNEIRDNITRMRREWEAERDALATVRRFNAKLSAKGYLWSWPKIAEIVAKL* |
Ga0066388_1008482073 | 3300005332 | Tropical Forest Soil | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWFWPKINAALT* |
Ga0066388_1018895791 | 3300005332 | Tropical Forest Soil | MGYNARNDEIRDNVTRMRREWEAQRGALAAVRRFNATLSAKGYVWFWPKIAAALT |
Ga0066388_1075462292 | 3300005332 | Tropical Forest Soil | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWF |
Ga0070673_1006144933 | 3300005364 | Switchgrass Rhizosphere | MGYNARNDEIRDNITRMKREWEAQRDALATVRRFNARLSAKGYSWFWPKVATEHYS |
Ga0070711_1001687494 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYNARNDEIRDNITRMKREWEAQRDALATVRRFNARLSAKGYSWFWPKVATEHYSLQNLKLRIL |
Ga0070685_109796622 | 3300005466 | Switchgrass Rhizosphere | MGYNARNDEIRDNITRMRRDWEEERDALAAVRRFNAKLSAKGYSWSWPKIAAA |
Ga0070695_1002672771 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYNARNDEIRDNITRMKREWEAQRDALATVRRFNARLSAKGYSWFWPKVATEHYSL |
Ga0068864_1000835311 | 3300005618 | Switchgrass Rhizosphere | MGYNARNDEIRDNITRMRRDWEEERDALAAVRRFNAKLSAKGYSWSWPKI |
Ga0066905_1003525852 | 3300005713 | Tropical Forest Soil | MGYNARNDEIRDNITRMRREWEAKRGALATVRRFNATLSAKGYVWFWPKIAQPR* |
Ga0066903_1011932312 | 3300005764 | Tropical Forest Soil | MGYNARNDEIRDIITRMRREWEAQRGALATVRRFNATLSAKGYVWFWPKINAALT* |
Ga0066903_1065735531 | 3300005764 | Tropical Forest Soil | LGYNARNDEIRDNITRMRREWEAQRSALAPMRRFNATLSAKGYV* |
Ga0066903_1084458991 | 3300005764 | Tropical Forest Soil | LGYNARNDEIRDNITRMRREWEAQRGALAAMRRFNATLSAKGYV* |
Ga0081455_1000914519 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGYNARNDEIRDNITRMQREWEAQRGALATVRRFNATLSAKGYSWFWPKTAAAPQNITG* |
Ga0081455_100491796 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGYNARNDEIRDNVARMQRECESQRSALATVRRFNAALSAKGDV* |
Ga0081540_10486576 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MGYNARNDEIRGNVTRLRADWEAQWQALATVRRLNATLSAKGYVWFWP |
Ga0075417_102235771 | 3300006049 | Populus Rhizosphere | MVGPMGYNVRNDEIRDNITRMRREWEVQRGALATVRRFNA |
Ga0075417_102674591 | 3300006049 | Populus Rhizosphere | MSYNARNDEIRDNVTRMRREWEAQRGALATVRRFNATLSAKDYV* |
Ga0075417_102952073 | 3300006049 | Populus Rhizosphere | MGYNARNDEIRDNVLRMKRDWEAQRGALATVRRFNARLSAKGYV |
Ga0097621_1007070393 | 3300006237 | Miscanthus Rhizosphere | GYNARNDEIRDNITKWEAERGALAIVRRFNATLSAKGYVWFWPKITPH* |
Ga0075421_1005620862 | 3300006845 | Populus Rhizosphere | MVGPMGYNARNDEIRDNITRMRREWEVQRGALATVRRFNAGRR* |
Ga0075430_1015305141 | 3300006846 | Populus Rhizosphere | MGYNARNDEIRDNVTRMRREWEAQRGALATVRRFNAI |
Ga0075425_1001776113 | 3300006854 | Populus Rhizosphere | MGYNARNDEIPDNVTRMRREWEAQRGAIATVRRFN |
Ga0075425_1022228942 | 3300006854 | Populus Rhizosphere | MGYNARNDEIRDNVTRVRREWEAQRGALATVRRFNATLSAKGYVP* |
Ga0075434_1003005942 | 3300006871 | Populus Rhizosphere | MGYNARNDEIPDNVTRMRREWEAQRGAIATVRRFNAILSAKGY |
Ga0075429_1011928022 | 3300006880 | Populus Rhizosphere | MVGPMGYNVRNDEIRDNITRMRREWEVQRGALATVRRFNAGRR* |
Ga0075424_1014550073 | 3300006904 | Populus Rhizosphere | MSRGLMGYNVRNDEIRDNVTRMRREWEAQRGAVATVRRFNAILSAKGY |
Ga0079219_101684974 | 3300006954 | Agricultural Soil | MGYNARNDEIRDNITRMRRDWEEERDALAAVRRFNAKLSAKGYSWSW |
Ga0075419_106840962 | 3300006969 | Populus Rhizosphere | MGYNARNDEIRDNITRMRREWEVQRGALATVRRFNAGRR* |
Ga0075435_1001829783 | 3300007076 | Populus Rhizosphere | MGYNTRNDEICDNVTRMQREWEKQRGALATVRHFNATLSAKGYVWFWPKI |
Ga0105251_101352781 | 3300009011 | Switchgrass Rhizosphere | MGYNARNDEIRDNITRMRRELEDQRQSLATVRRFNASLSAKGYSW |
Ga0111539_111132842 | 3300009094 | Populus Rhizosphere | MGYNARNDEIRDNVTRMRADWKAQRQALVTVRRFSATLSANGYVWFWPKVAARG* |
Ga0114129_102741025 | 3300009147 | Populus Rhizosphere | MGYNARNDEIRDNVTRMRREWEAQRGALATVRRFNAILSGKGYSWFWPKIA |
Ga0114129_103598414 | 3300009147 | Populus Rhizosphere | MGYNARNDEIRDNVTRMKREWEAQRGALATVRRFNATLSAKGYVWFWPKIAAAL |
Ga0114129_104697631 | 3300009147 | Populus Rhizosphere | MGYNARNDEIRDNITKMRREWEAQRDALATVRRFNARLSAKGS |
Ga0114129_120088191 | 3300009147 | Populus Rhizosphere | MGYNARNDKIRDNVTRMRREWEAQRGALATVRRFNATLSAKGYVP* |
Ga0114129_129271021 | 3300009147 | Populus Rhizosphere | MGYNVRNDEIRDNITRMRREWEVQRGALATVRRFNAIPS |
Ga0111538_101255397 | 3300009156 | Populus Rhizosphere | MGYNARNDEIRDNVTRMQREWEAQRGALATVRRFNATL |
Ga0075423_107503501 | 3300009162 | Populus Rhizosphere | MGYNARNDEIRDNVTRMRDEWDAQRGALATVRRFNATLSAKGYVWFWPKIAAALT |
Ga0075423_119611521 | 3300009162 | Populus Rhizosphere | NARNDKIRDDVTRMRREWEAQWGALATVRRFNATLSAKGYVP* |
Ga0075423_121873361 | 3300009162 | Populus Rhizosphere | MGYNAHNDETRDNVTRMRREWEAERGALATVRRFNATLSAKGYVWF* |
Ga0105104_101392763 | 3300009168 | Freshwater Sediment | MGYNARNDEIRDNVTRMRREWEAQRGALATVRRFNAILSAKGYSWFW |
Ga0118657_119419722 | 3300009506 | Mangrove Sediment | MGYNARNNEIHDNITRLRRAWEAEREAPATVRRFNARLSAKSHVWFWPKITAAITA |
Ga0118657_122214821 | 3300009506 | Mangrove Sediment | MGYSHHSNGICDYIVRMQREWEAERNALATMRRFNARLSAKGYA* |
Ga0126374_100515773 | 3300009792 | Tropical Forest Soil | LDARNDEIPDNVTRMRREWKAQRDALATVRRFNATLSD* |
Ga0126374_110199262 | 3300009792 | Tropical Forest Soil | VIGSNGYNACNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWFWP* |
Ga0126374_111428992 | 3300009792 | Tropical Forest Soil | MGYNARNDEIRDNVTRMRREWEAQRGALATVRRFNATLS |
Ga0126380_100251722 | 3300010043 | Tropical Forest Soil | MGYSARNDEIRDNITRMRREWEAQRGALATVRRFNAFG* |
Ga0126380_109668481 | 3300010043 | Tropical Forest Soil | MGYNARNDEIRDNVTRMQREWEAQRGALATVRRFNATLSANGY |
Ga0126384_100140217 | 3300010046 | Tropical Forest Soil | MGYNARNDKIRDNVMRMQREWEAQRGALATVRRFNATISAKGYVWFWP |
Ga0126384_104364701 | 3300010046 | Tropical Forest Soil | MGYNARNDEIRDNITRMRREWEAKRGALATVRRFNATLSAKGYVWFLPKIAQPR* |
Ga0126384_111899382 | 3300010046 | Tropical Forest Soil | MGYNARNDEIRDNVTRMRREWQAERAALATVRRFNAT |
Ga0126384_113439661 | 3300010046 | Tropical Forest Soil | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYV |
Ga0126384_115536281 | 3300010046 | Tropical Forest Soil | MGYNARNDEIRDNITRMRRQWEAERGALATVRRFNATLSAKGYVWFWPKIAAALT* |
Ga0126384_117181772 | 3300010046 | Tropical Forest Soil | LGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKAYSSRLPLI |
Ga0126384_121200762 | 3300010046 | Tropical Forest Soil | MGYNARNDEIRDNITRMRREWEAKRGALATVRRFN |
Ga0126384_122493392 | 3300010046 | Tropical Forest Soil | VIGSNGYNARNDEIRDNITRMRREWEAQRGALATLRRFNATLSAKGYVWFWPK |
Ga0126382_123946371 | 3300010047 | Tropical Forest Soil | HGAMGYNARNGEIRDNVTRLRCEWEAQRGALATVRRFKATLSAKGYVWF* |
Ga0126373_101859632 | 3300010048 | Tropical Forest Soil | VIGSNGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWFWL* |
Ga0126370_102054161 | 3300010358 | Tropical Forest Soil | EIRDNITRMRREWEAQRGALATVRRFSAALSAKGYVWF* |
Ga0126376_131191941 | 3300010359 | Tropical Forest Soil | MGYNARNDEIRYNITRMRREWEAKRGARATVRRFNATLSAKGYVWFWPKIARPR* |
Ga0126372_126949652 | 3300010360 | Tropical Forest Soil | MGYNARNDEIRDNITRMRQEREAQRGALATVRRFNATLSAKGYVWFWPKIAA |
Ga0126378_102077233 | 3300010361 | Tropical Forest Soil | VIGSNGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWFWP* |
Ga0126377_100983755 | 3300010362 | Tropical Forest Soil | MGYNARNDEIRDNVTRMRREWEAERIALATVRRFN |
Ga0126377_122971401 | 3300010362 | Tropical Forest Soil | MGYNARNDEIRDNFTRMRREWEAQRGALATVRRFKCCAFRQR |
Ga0124850_10510791 | 3300010863 | Tropical Forest Soil | MGYNARNDEIRDNITRMRREWEAKRGALATVRRFNATLSAKG* |
Ga0126375_101328381 | 3300012948 | Tropical Forest Soil | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGY |
Ga0126375_104766263 | 3300012948 | Tropical Forest Soil | MGYNARNDEIRDNVTRMQREWQAERDALATVRRFNAILSTRGK |
Ga0126375_115778101 | 3300012948 | Tropical Forest Soil | MGYNARNDEIRDNITRMRREWEAKRGALATVRRFNATLSAKGYVW |
Ga0164300_102880234 | 3300012951 | Soil | MGYNARNDEIRDNITRMRRDWEEERDALAAVRRFNAKLSAKGYSWSWPKIAAALKSK |
Ga0164298_104466373 | 3300012955 | Soil | MGYSSRNDEIRDNITRMRRDWQAQREALAVVRRFNATLSAKGYVWFW |
Ga0164302_110493651 | 3300012961 | Soil | MGYNARNDEIRDNITRMRQEWEAERGALATVRRFNATLSAKGYVWFWPKI |
Ga0164309_103867661 | 3300012984 | Soil | MGYNARNDEIRDNITRMRRDWEEERDALAAVRRFNAKLSAKGYSWSWPK |
Ga0164309_117995792 | 3300012984 | Soil | MGYNARNDEIRDNIVRMQREWEAQRDAMAIVRRFNARLSAKGYSWFWPKI |
Ga0164307_116061752 | 3300012987 | Soil | MGYNARNDEIRDNVTRMRREWEAQRNALATVRRFNATLSA |
Ga0157369_108308503 | 3300013105 | Corn Rhizosphere | MGYNARNDEIRDNITRMKREWEAQRDALATVRRFNARLSAKGYSWFWPKV |
Ga0157378_107085221 | 3300013297 | Miscanthus Rhizosphere | MGYNARNDEIRDNITRMKREWEAQRDALATVRRFNARL |
Ga0163162_133093102 | 3300013306 | Switchgrass Rhizosphere | MGYNARNDEICDNITRMRREWEAQHRALATVRRFNAIMSS |
Ga0157377_112830281 | 3300014745 | Miscanthus Rhizosphere | MGYNARNDEIRDNVTRMRREWEAQRGSLATVRRFNATLSAKG |
Ga0157379_125159401 | 3300014968 | Switchgrass Rhizosphere | MGYNARNDEIRDNITRMKRDWAAQKAALATVRRFNAKAIGQWLFV* |
Ga0132258_102251525 | 3300015371 | Arabidopsis Rhizosphere | MGYNARNDEIRDNVTRMRREREAQRDALATVRRFNARLSAKEYVWFWPKIAAALT* |
Ga0132258_122212774 | 3300015371 | Arabidopsis Rhizosphere | MGYNARNDEIRDNVTRMRREWEAQRGSLATVRRYNA |
Ga0132256_1017930062 | 3300015372 | Arabidopsis Rhizosphere | MGYNARNDEIRDNVTRMRREWEAQRGALATVRAA* |
Ga0132256_1029747321 | 3300015372 | Arabidopsis Rhizosphere | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAK |
Ga0132257_1026070831 | 3300015373 | Arabidopsis Rhizosphere | MGYNARNDEIRDNITRMQRDWQAQRDALAAVRRFNATLSAKGKVW |
Ga0132257_1034045641 | 3300015373 | Arabidopsis Rhizosphere | MGYNARNDEIRDNVTRMRREWEAQRNALATVRRFNATLSAKGYCWFWPKVGAA |
Ga0132257_1034329261 | 3300015373 | Arabidopsis Rhizosphere | MGYNARNDEIRVNITRMRREWEEERYALATVRRFNAKLSSKGY |
Ga0132255_1030224591 | 3300015374 | Arabidopsis Rhizosphere | LTAVYHQQMGYNARNDEIRDNITRMRRQWEEERDALAAVRRFNAK |
Ga0182036_113697571 | 3300016270 | Soil | MGYNARNDEIHENLESMRRERESYEDSLAVVRQFNARLSVKKTAWF |
Ga0182035_1000065816 | 3300016341 | Soil | MGDNARNDEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGYVITG |
Ga0182032_102246371 | 3300016357 | Soil | MGYNARNDEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGYVW |
Ga0182032_105474802 | 3300016357 | Soil | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWFWPKIAAAL |
Ga0182034_100001321 | 3300016371 | Soil | NARNDEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGYVITG |
Ga0187777_102377764 | 3300017974 | Tropical Peatland | MGYKARNDEIHDNTVRMQRAWEAEREALAIVRRFNAKLSAKGYVWFWPKITAALTQNTRG |
Ga0187822_101362461 | 3300017994 | Freshwater Sediment | MGYNARNDEIHDNIVRMQRALAAERYALATVRRFNAKFSADGSV |
Ga0184608_101298762 | 3300018028 | Groundwater Sediment | MGYNARNDEIRDNVTRMRREWEAQRDALATVRRFNARLSA |
Ga0184621_101233953 | 3300018054 | Groundwater Sediment | MGYNARNDEIRDSVTRMRREWEAQRDALATVRRFNARLSAKGYVWFWPKIA |
Ga0193719_102461962 | 3300021344 | Soil | MGYNARNDEIRDNVTRMRREWEAQRDALATVRRFNARLSTKGYS |
Ga0126371_103330402 | 3300021560 | Tropical Forest Soil | VIGSNGYNACNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWFWP |
Ga0126371_124730732 | 3300021560 | Tropical Forest Soil | MGYSARNDEIRDNITRMRREWEAQRGATLATVRRFNAFG |
Ga0207692_108875381 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYNARNDEICDNITRMRREWEAQHRALATVRRFNAIMSSKGH |
Ga0207663_104748933 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYNARNDEIRDNITRMKREWEAQRDALATVRRFNARLSAKGYSWFWPKVATEHYSLQNLKLRILTCL |
Ga0207650_106145001 | 3300025925 | Switchgrass Rhizosphere | MGYNARNDEIRDNVTRMRREWEAQRGSLATVRRFNATLSAKGYV |
Ga0209839_102890642 | 3300026294 | Soil | MGYNARNDDIHDNIVRMQREWEAQRDALATVRRFNARLSAKGTG |
Ga0207742_1013344 | 3300026800 | Tropical Forest Soil | MGYNARNDEIHENLERMRLEREAYEDSLAIVRQFNARLSAKKTAWFWP |
Ga0207801_1006681 | 3300026810 | Tropical Forest Soil | MGYNARNDEIHENLERMRLEREAYEDSLAIVRQFN |
Ga0207764_1182451 | 3300026839 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREDYEDSLAIVRQFNARLSAKKTAWFWPTVGA |
Ga0208404_10069182 | 3300026855 | Soil | MGYNARNDEIRDNITRMRRDWEEERDALAAVRRFNAKLSAKG |
Ga0207823_1049251 | 3300026860 | Tropical Forest Soil | MGYNARNDEIHENVERMRREREAYEDSLAIVRQFNARLS |
Ga0207821_10184781 | 3300026869 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREAYEDALAIVRQFNARLSAKKT |
Ga0207821_10204851 | 3300026869 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREAYEDSLAIVRQFN |
Ga0207745_10027442 | 3300026889 | Tropical Forest Soil | MGYNARNDEIHENVERMRREREAYEDSLAIVRQFNARLSAKRPHGSGRQ |
Ga0207730_10134661 | 3300026896 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREAYEDALAIVRQFNARLSTKTT |
Ga0207858_10104612 | 3300026909 | Tropical Forest Soil | MGYNARNDEIHENVERMRREREAYEDSLAIVRQFNARLSAK |
Ga0207835_10214612 | 3300026953 | Tropical Forest Soil | MGYNARNDEIHENLERMRLEREAYEDSLAIVRQFNARLSAKKTAWFWPTI |
Ga0207839_10034261 | 3300027010 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREAYEDSLAIVRQFNAR |
Ga0207839_10258701 | 3300027010 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREAYEDSLAIVRQFNAC |
Ga0207740_10052491 | 3300027011 | Tropical Forest Soil | MGYNARNDEIRDNVTRMRREWEAQRDALATVRRFNPRLSAKGYSWFCRYR |
Ga0207740_10290571 | 3300027011 | Tropical Forest Soil | MGYNARNDEIHENVERMRREREAYEDSLAIVRQFNARLSAKKTAWFWP |
Ga0207855_10517182 | 3300027039 | Tropical Forest Soil | MGYNARNDEIHENLKRMRREREAYEDALAIVRQFNAR |
Ga0207726_10097051 | 3300027045 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREDYEDALAIVRQFNARLSAKMT |
Ga0207780_10259834 | 3300027313 | Tropical Forest Soil | MGYNARNDEIHENVKRMRREREAYEDSFAIVRQFNARLSAK |
Ga0207780_10762751 | 3300027313 | Tropical Forest Soil | MGYNARNDEIHENLERMHREREAYEDSLAIVRQDN |
Ga0207761_10892911 | 3300027516 | Tropical Forest Soil | MGYNARNDEIDENLERMRREREAYEDALAIVRQFNARLSAKK |
Ga0207826_11556941 | 3300027680 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREAYEDSLAIVRQFNARLSAKK |
Ga0207826_11925911 | 3300027680 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREAYEDALAIVRQFNARL |
Ga0207862_11149792 | 3300027703 | Tropical Forest Soil | MGYNARNDEIHENLEHMRREREAYEDSLAIVRQFNARLSAKKPHGSGRQ |
Ga0207862_12521521 | 3300027703 | Tropical Forest Soil | MGYNARNDEIHENLERMRREREAYEDSLAIVRQFNARL |
Ga0209814_101653081 | 3300027873 | Populus Rhizosphere | MSYNARNDEIRDNVTRMRREWEAQRGALATVRRFNATLSAKGYV |
Ga0209814_105361092 | 3300027873 | Populus Rhizosphere | MGYNARNDEIRDNVLRMKRDWEAQRGALATVRRFNARLSAKGYVWF |
Ga0209465_100336711 | 3300027874 | Tropical Forest Soil | MGYNARNDEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGYVWFWPKI |
Ga0307301_103187621 | 3300028719 | Soil | MGYNARNDEIRDNVTRMRREWEAQRDALATVRRFNARLSAKGYVWFWPKIAAA |
Ga0307282_104209751 | 3300028784 | Soil | MGYNARNDEIRDNVTRMRREWEAQRDALATVRRFNARLSAK |
Ga0307296_102212442 | 3300028819 | Soil | MGYNARNDEIRDNVTRMQREWEAQRNALATVRRFNATLSAKA |
Ga0307278_104658701 | 3300028878 | Soil | MGYNARNDEIRDNVTRMRREWEAQRNALATVRRFN |
Ga0307497_100304821 | 3300031226 | Soil | MGYNARNDEIRDNITRMRREWEAQSGALATVRGNPLWMY |
Ga0307497_101542232 | 3300031226 | Soil | MGYNARNDEIRDNVTRMQREWEAQRNALATVRRFNATLSAKGCVWFWP |
Ga0307497_103186762 | 3300031226 | Soil | MGYNARNDEIRDNVTRMRREWEAQRDALATVRRFNARLSAKGYS |
Ga0170824_1120835081 | 3300031231 | Forest Soil | MDYNARNDEIRDNVTRMRREWEAQRNALATVRRFNATLSAK |
Ga0170820_123212421 | 3300031446 | Forest Soil | MSYNARNDEIRDNITRMRREWEAQRNALATVRRFN |
Ga0170820_152852001 | 3300031446 | Forest Soil | MGYNARNDEIRDNVTRMRREWEAQRNALATVRRFNATLSAK |
Ga0170819_127799721 | 3300031469 | Forest Soil | MGYNARNDEIRDNVTRMRREWAAQRSALATVRRFNATLSAKGYV |
Ga0318516_102105201 | 3300031543 | Soil | MGYNARNDEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGYVITG |
Ga0318534_103618403 | 3300031544 | Soil | MGYNARNDEIRDNITRMRQEWEAQRGALATVRRFNA |
Ga0310915_100705573 | 3300031573 | Soil | MGYNARNDEIHENLERMRREREAHEDALAIVRQLRPAIT |
Ga0310915_112777762 | 3300031573 | Soil | MGHNARNDEIEENLERMRREREAYEDGLAIVRQFNGRLSANKTAWCP |
Ga0318537_101766851 | 3300031763 | Soil | MGYNARNDEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGYVWFWP |
Ga0318566_103996961 | 3300031779 | Soil | MGYNACNDEIRDNITRMRQEWEAQRGALATVRRFNARLSAKGYVWFWPKFA |
Ga0318557_106075322 | 3300031795 | Soil | MGYNARNDEIRDNITRMRQEWEAQRGALATVRRFN |
Ga0318550_100906354 | 3300031797 | Soil | MGYNACNDEIRDNITRMRQEWEAQRGALATVRRFNARLSAKGYVWF |
Ga0318568_106097701 | 3300031819 | Soil | MGYNVRNDEIHENLERMRREREAHEDALAIVRQLLPAIT |
Ga0318520_105908242 | 3300031897 | Soil | MGYNARNDEIRDNITRMRQEWEAQRGALATVRRFNATLS |
Ga0310900_112613311 | 3300031908 | Soil | MGYNSRNDEIRDNITRMRGQWEASEALAIVRRFNATLS |
Ga0306923_116659101 | 3300031910 | Soil | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWFWPKIAAALTSKHH |
Ga0306921_110264451 | 3300031912 | Soil | MGYNARNDEIHENLERMRREREAYEDALAIVRQFN |
Ga0306921_113639511 | 3300031912 | Soil | VGYNARNDEIHENLERMRREREAYEDSLAIVRQFNARL |
Ga0306921_115703961 | 3300031912 | Soil | LDSNARNDEIDENLERMRRDREAYEDSLAIVRQFNAR |
Ga0310912_113357792 | 3300031941 | Soil | MGHNARNDGIEENLERMRREREAYEDGLAIVRQFNARLSANKTAWF |
Ga0310885_103980262 | 3300031943 | Soil | MGYNARNDEIRDNVTRMRREWEAQRGALATVRRFNAILSAKGYVWFW |
Ga0310884_108512282 | 3300031944 | Soil | MGYNARNDEIRDNVTRMQREWEAERGALATVRRFNATLSAKGYVWFWPKIAA |
Ga0310913_100008901 | 3300031945 | Soil | DEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGYVITG |
Ga0310913_1000301615 | 3300031945 | Soil | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWFWPKIAAA |
Ga0310910_115383701 | 3300031946 | Soil | MGYNARNDEIHENLERMRREREAYEDALAIVRQFNARLSAK |
Ga0310909_111200001 | 3300031947 | Soil | MGYNARNDEIRDNITRMRREWEAQRGALATVRRFNATLSAKGYVWFWPK |
Ga0306926_129930282 | 3300031954 | Soil | MGYNARNDEIHENLERMRRKREAYEDALAIVRQFNARLSA |
Ga0306922_100334696 | 3300032001 | Soil | MGYNARNDEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGY |
Ga0306922_100556261 | 3300032001 | Soil | YNARNDEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGYVITG |
Ga0318545_100805021 | 3300032042 | Soil | MGYNARNDEIRDNITRMRQEWEAQRGALATVRRFNATLSAKGYV |
Ga0306924_100024481 | 3300032076 | Soil | MGYNARNDEIRDNITRVRREWEAQRGALATVRRFNATLSAKGYVWFWPKIAAA |
Ga0306924_114459402 | 3300032076 | Soil | MGYNARNDEIHENLERMRWEREAYEDSLAIVRQFNARLSAKKT |
Ga0318540_102436701 | 3300032094 | Soil | DGLMGYNARNDEIHENLERMRREREAHEDALAIVRQLRPAIT |
Ga0306920_1031274231 | 3300032261 | Soil | MGYNARNDEIHENLERMQREREAYEDSLAIVRQFNARLS |
Ga0326723_0145858_1_114 | 3300034090 | Peat Soil | MGYNARNDEIRDNIERMRRDREACADALAIVRQFNARL |
Ga0373958_0056838_710_817 | 3300034819 | Rhizosphere Soil | MGYNARNDEIRDNITRMRQEREAQRGALATVWRFN |
⦗Top⦘ |