Metagenome / Metatranscriptome Family F021258

Overview

Basic Information

• Family ID: F021258
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 219
• Average Sequence Length: 39 residues
• Representative Sequence: VQAPLGVARLLDRMDLRPQVVGAQEIVGDPQPAGRVAL
• Number of Associated Samples: 175
• Number of Associated Scaffolds: 219

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 54.13 %
• % of genes near scaffold ends (potentially truncated): 15.98 %
• % of genes from short scaffolds (< 2000 bps): 79.00 %
• Associated GOLD sequencing projects: 165
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (93.151 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (15.982 % of family members)
• Environment Ontology (ENVO): Unclassified (37.443 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (29.680 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 16.67%
  β-sheet: 0.00%
  Coil/Unstructured: 83.33%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 219 Family Scaffolds
PF14279	HNH_5	48.40
PF00216	Bac_DNA_binding	12.33
PF00730	HhH-GPD	6.85
PF01844	HNH	6.39
PF03480	DctP	1.37
PF04290	DctQ	1.37
PF00920	ILVD_EDD	1.37
PF11734	TilS_C	0.91
PF00990	GGDEF	0.91
PF14334	DUF4390	0.46
PF14833	NAD_binding_11	0.46
PF08534	Redoxin	0.46
PF06808	DctM	0.46
PF01613	Flavin_Reduct	0.46
PF00892	EamA	0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 219 Family Scaffolds
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	12.33
COG0122	3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase	Replication, recombination and repair [L]	6.85
COG0177	Endonuclease III	Replication, recombination and repair [L]	6.85
COG1059	Thermostable 8-oxoguanine DNA glycosylase	Replication, recombination and repair [L]	6.85
COG1194	Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs	Replication, recombination and repair [L]	6.85
COG2231	3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily	Replication, recombination and repair [L]	6.85
COG0129	Dihydroxyacid dehydratase/phosphogluconate dehydratase	Carbohydrate transport and metabolism [G]	2.74
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	0.46

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.15 %
Unclassified	root	N/A	6.85 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.15 %
Unclassified	root	N/A	6.85 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.15 %
Unclassified	root	N/A	6.85 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	91.78 %
Unclassified	root	N/A	6.85 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.46 %

Level 5

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	66.21 %
Unclassified	root	N/A	6.85 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.91 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.46 %

Level 6

Name	Rank	Taxonomy	Distribution
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	22.37 %
Unclassified	root	N/A	6.85 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.91 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.91 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.46 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.46 %

Level 7

Name	Rank	Taxonomy	Distribution
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	22.37 %
Unclassified	root	N/A	6.85 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.91 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.46 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.46 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.46 %

Level 8

Name	Rank	Taxonomy	Distribution
Aromatoleum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum	22.37 %
Unclassified	root	N/A	6.85 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.91 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.46 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.46 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.46 %

Level 9

Name	Rank	Taxonomy	Distribution
Aromatoleum aromaticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum	22.37 %
Unclassified	root	N/A	6.85 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.91 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.46 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.46 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.46 %

Level 10

Name	Rank	Taxonomy	Distribution
Aromatoleum aromaticum EbN1	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	22.37 %
Unclassified	root	N/A	6.85 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.91 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.46 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.46 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.46 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000156|NODE_c0515837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1088
3300000890|JGI11643J12802_11028343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	630
3300000953|JGI11615J12901_10493100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	673
3300004052|Ga0055490_10172481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	644
3300004463|Ga0063356_104623727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	592
3300005340|Ga0070689_100072363	All Organisms → cellular organisms → Bacteria → Proteobacteria	2694
3300005441|Ga0070700_100245986	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1280
3300005561|Ga0066699_10282410	All Organisms → cellular organisms → Bacteria → Proteobacteria	1179
3300005577|Ga0068857_101622067	All Organisms → cellular organisms → Bacteria → Proteobacteria	632
3300005713|Ga0066905_100688531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	876
3300005719|Ga0068861_100049275	All Organisms → cellular organisms → Bacteria → Proteobacteria	3188
3300005829|Ga0074479_10081927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1370
3300005844|Ga0068862_100621322	All Organisms → cellular organisms → Bacteria → Proteobacteria	1039
3300005890|Ga0075285_1036350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	632
3300006046|Ga0066652_100542391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1088
3300006845|Ga0075421_100464505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1510
3300006845|Ga0075421_101420810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	763
3300006846|Ga0075430_100026682	All Organisms → cellular organisms → Bacteria → Proteobacteria	4913
3300006846|Ga0075430_100358817	All Organisms → cellular organisms → Bacteria → Proteobacteria	1203
3300006847|Ga0075431_101550581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	620
3300006876|Ga0079217_10554517	All Organisms → cellular organisms → Bacteria → Proteobacteria	732
3300006876|Ga0079217_10609992	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	711
3300006876|Ga0079217_11368105	All Organisms → cellular organisms → Bacteria → Proteobacteria	551
3300006876|Ga0079217_11379678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	549
3300006880|Ga0075429_100525971	All Organisms → cellular organisms → Bacteria → Proteobacteria	1036
3300006894|Ga0079215_10024566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2075
3300006894|Ga0079215_10903284	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	634
3300006918|Ga0079216_11659076	Not Available	543
3300007004|Ga0079218_11091373	All Organisms → cellular organisms → Bacteria → Proteobacteria	813
3300007004|Ga0079218_11141947	All Organisms → cellular organisms → Bacteria → Proteobacteria	800
3300007004|Ga0079218_13852833	All Organisms → cellular organisms → Bacteria → Proteobacteria	510
3300009037|Ga0105093_10098137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1409
3300009038|Ga0099829_10533955	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	974
3300009038|Ga0099829_11617389	Not Available	534
3300009053|Ga0105095_10001993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	10887
3300009053|Ga0105095_10182467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1149
3300009078|Ga0105106_10029279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4067
3300009078|Ga0105106_10176965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1562
3300009078|Ga0105106_10276234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1218
3300009082|Ga0105099_10090775	All Organisms → cellular organisms → Bacteria → Proteobacteria	1665
3300009089|Ga0099828_10137495	All Organisms → cellular organisms → Bacteria → Proteobacteria	2149
3300009094|Ga0111539_13393254	Not Available	512
3300009137|Ga0066709_100265935	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2307
3300009147|Ga0114129_10267199	All Organisms → cellular organisms → Bacteria → Proteobacteria	2290
3300009147|Ga0114129_13088056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	545
3300009153|Ga0105094_10654909	Not Available	614
3300009156|Ga0111538_10045006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5672
3300009156|Ga0111538_11144489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	984
3300009157|Ga0105092_10051876	All Organisms → cellular organisms → Bacteria → Proteobacteria	2202
3300009444|Ga0114945_10024147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3249
3300009678|Ga0105252_10001499	All Organisms → cellular organisms → Bacteria → Proteobacteria	10328
3300009806|Ga0105081_1029543	All Organisms → cellular organisms → Bacteria → Proteobacteria	718
3300010159|Ga0099796_10097226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1103
3300010335|Ga0134063_10762355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	505
3300010371|Ga0134125_11848461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	657
3300010391|Ga0136847_12590619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	732
3300010399|Ga0134127_10049136	All Organisms → cellular organisms → Bacteria → Proteobacteria	3484
3300010399|Ga0134127_10054594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3322
3300010399|Ga0134127_13103236	Not Available	542
3300010401|Ga0134121_11714649	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	652
3300010403|Ga0134123_10881394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	898
3300011119|Ga0105246_10513968	Not Available	1019
3300011269|Ga0137392_10178705	All Organisms → cellular organisms → Bacteria → Proteobacteria	1727
3300011395|Ga0137315_1002968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1656
3300011402|Ga0137356_1017361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1284
3300011432|Ga0137428_1007057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3094
3300011433|Ga0137443_1069384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	983
3300011437|Ga0137429_1053830	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1180
3300011438|Ga0137451_1035533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1450
3300011439|Ga0137432_1032071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1549
3300011445|Ga0137427_10088877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1241
3300012034|Ga0137453_1022182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1015
3300012039|Ga0137421_1060303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1045
3300012040|Ga0137461_1117156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	770
3300012096|Ga0137389_10759639	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	833
3300012142|Ga0137343_1000015	All Organisms → cellular organisms → Bacteria → Proteobacteria	13386
3300012142|Ga0137343_1028294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	763
3300012161|Ga0137336_1009200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1707
3300012166|Ga0137350_1031689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1004
3300012206|Ga0137380_10016114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	6835
3300012207|Ga0137381_10027509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4562
3300012225|Ga0137434_1022468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	837
3300012227|Ga0137449_1000374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7356
3300012227|Ga0137449_1082604	Not Available	689
3300012232|Ga0137435_1049248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1236
3300012232|Ga0137435_1121774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	790
3300012360|Ga0137375_10051065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4513
3300012673|Ga0137339_1002485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1266
3300012675|Ga0137337_1008624	All Organisms → cellular organisms → Bacteria → Proteobacteria	1327
3300012685|Ga0137397_11041149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	600
3300012910|Ga0157308_10073393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	949
3300012913|Ga0157298_10036264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1053
3300012917|Ga0137395_10549257	All Organisms → cellular organisms → Bacteria → Proteobacteria	833
3300012922|Ga0137394_10390845	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1186
3300012924|Ga0137413_11017586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	651
3300012984|Ga0164309_11753162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	533
3300014259|Ga0075311_1016663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1289
3300014320|Ga0075342_1100364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	753
3300014326|Ga0157380_10213350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1722
3300014867|Ga0180076_1072690	All Organisms → cellular organisms → Bacteria → Proteobacteria	632
3300014868|Ga0180088_1022150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1005
3300014870|Ga0180080_1031808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	811
3300014871|Ga0180095_1001910	All Organisms → cellular organisms → Bacteria → Proteobacteria	2442
3300014885|Ga0180063_1105698	All Organisms → cellular organisms → Bacteria → Proteobacteria	863
3300015248|Ga0180079_1020607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	820
3300015249|Ga0180071_1049121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	630
3300015252|Ga0180075_1001716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1851
3300015253|Ga0180081_1010842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1254
3300015254|Ga0180089_1010250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1619
3300015256|Ga0180073_1148007	Not Available	507
3300017792|Ga0163161_10574010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	927
3300017999|Ga0187767_10249167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	584
3300018055|Ga0184616_10028405	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1765
3300018063|Ga0184637_10571560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	646
3300018070|Ga0184631_10008236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3172
3300018078|Ga0184612_10536956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	564
3300018083|Ga0184628_10002123	All Organisms → cellular organisms → Bacteria → Proteobacteria	9567
3300018089|Ga0187774_10015563	All Organisms → cellular organisms → Bacteria → Proteobacteria	2898
3300018422|Ga0190265_10056445	All Organisms → cellular organisms → Bacteria → Proteobacteria	3461
3300018422|Ga0190265_10072077	All Organisms → cellular organisms → Bacteria → Proteobacteria	3123
3300018422|Ga0190265_10114437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2562
3300018422|Ga0190265_10247114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1829
3300018422|Ga0190265_12978928	Not Available	566
3300018429|Ga0190272_10169906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1532
3300018429|Ga0190272_12123641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	599
3300018432|Ga0190275_10590327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1157
3300018432|Ga0190275_11000024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	907
3300018432|Ga0190275_11610681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	727
3300019212|Ga0180106_1014269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	678
3300020146|Ga0196977_1021619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1552
3300020202|Ga0196964_10003295	All Organisms → cellular organisms → Bacteria → Proteobacteria	7499
3300020202|Ga0196964_10190610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	944
3300021063|Ga0206227_1002155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2273
3300021082|Ga0210380_10002647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7365
3300021082|Ga0210380_10447899	All Organisms → cellular organisms → Bacteria → Proteobacteria	591
3300021090|Ga0210377_10527343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	677
3300021264|Ga0213895_100040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	2114
3300022204|Ga0224496_10066149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1616
3300022563|Ga0212128_10040115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3016
3300023066|Ga0247793_1051225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	661
3300025001|Ga0209618_1036493	Not Available	788
3300025155|Ga0209320_10082243	All Organisms → cellular organisms → Bacteria → Proteobacteria	1494
3300025167|Ga0209642_10101965	All Organisms → cellular organisms → Bacteria → Proteobacteria	1659
3300025318|Ga0209519_10729875	All Organisms → cellular organisms → Bacteria → Proteobacteria	531
3300025327|Ga0209751_10195111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1735
3300025885|Ga0207653_10129063	All Organisms → cellular organisms → Bacteria	916
3300025898|Ga0207692_10056220	All Organisms → cellular organisms → Bacteria → Proteobacteria	2018
3300025901|Ga0207688_10081334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1850
3300025917|Ga0207660_10024138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4113
3300025917|Ga0207660_10097237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2193
3300025917|Ga0207660_11045052	All Organisms → cellular organisms → Bacteria → Proteobacteria	666
3300025918|Ga0207662_10063094	All Organisms → cellular organisms → Bacteria → Proteobacteria	2228
3300025918|Ga0207662_10297128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1072
3300025938|Ga0207704_10957187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	722
3300025960|Ga0207651_10317594	All Organisms → cellular organisms → Bacteria → Proteobacteria	1301
3300026047|Ga0208658_1011801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	686
3300026116|Ga0207674_11687056	All Organisms → cellular organisms → Bacteria → Proteobacteria	602
3300026320|Ga0209131_1059765	All Organisms → cellular organisms → Bacteria → Proteobacteria	2118
3300026320|Ga0209131_1136344	All Organisms → cellular organisms → Bacteria → Proteobacteria	1258
3300026542|Ga0209805_1089099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1482
3300027326|Ga0209731_1051794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	622
3300027360|Ga0209969_1005987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1709
3300027360|Ga0209969_1046238	All Organisms → cellular organisms → Bacteria → Proteobacteria	680
3300027378|Ga0209981_1055051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	605
3300027395|Ga0209996_1004439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1779
3300027573|Ga0208454_1011365	All Organisms → cellular organisms → Bacteria → Proteobacteria	2219
3300027639|Ga0209387_1055047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	885
3300027650|Ga0256866_1171826	Not Available	586
3300027717|Ga0209998_10136084	All Organisms → cellular organisms → Bacteria → Proteobacteria	626
3300027731|Ga0209592_1009786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3533
3300027731|Ga0209592_1217194	All Organisms → cellular organisms → Bacteria → Proteobacteria	670
3300027846|Ga0209180_10762749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	521
3300027875|Ga0209283_10021366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3972
3300027875|Ga0209283_10207715	All Organisms → cellular organisms → Bacteria	1300
3300027907|Ga0207428_10424646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	971
3300027907|Ga0207428_11243893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	517
3300027909|Ga0209382_10228509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2121
3300027955|Ga0209078_1115885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	761
3300028420|Ga0210366_10056778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1282
3300028802|Ga0307503_10117731	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1159
3300028812|Ga0247825_10096905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1994
3300030606|Ga0299906_10167042	All Organisms → cellular organisms → Bacteria → Proteobacteria	1743
3300030619|Ga0268386_10015359	All Organisms → cellular organisms → Bacteria → Proteobacteria	5968
3300030619|Ga0268386_10204373	Not Available	1478
3300030620|Ga0302046_10181571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1729
3300030620|Ga0302046_11041011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	649
3300031228|Ga0299914_11263047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	588
3300031229|Ga0299913_11047990	All Organisms → cellular organisms → Bacteria → Proteobacteria	780
3300031507|Ga0307509_10823008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	593
3300031548|Ga0307408_100329768	All Organisms → cellular organisms → Bacteria → Proteobacteria	1288
3300031548|Ga0307408_100557060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1012
3300031576|Ga0247727_10009356	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	17800
3300031576|Ga0247727_10204014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	1805
3300031911|Ga0307412_10123245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1870
3300031944|Ga0310884_10360918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	826
3300032000|Ga0310903_10285332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	807
3300032002|Ga0307416_100268185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1674
3300032003|Ga0310897_10027162	All Organisms → cellular organisms → Bacteria → Proteobacteria	1897
3300032005|Ga0307411_11347848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	651
3300032126|Ga0307415_100493936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1068
3300032157|Ga0315912_11529022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	525
3300032180|Ga0307471_101044450	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	984
3300032180|Ga0307471_102745644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	625
3300032205|Ga0307472_100059515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2433
3300032829|Ga0335070_10251203	All Organisms → cellular organisms → Bacteria → Proteobacteria	1733
3300033407|Ga0214472_10207459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1893
3300033433|Ga0326726_12134667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	545
3300033805|Ga0314864_0093395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	728
3300033811|Ga0364924_011421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1653
3300033811|Ga0364924_030741	Not Available	1097
3300033811|Ga0364924_145082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	557
3300033815|Ga0364946_082806	Not Available	698
3300034115|Ga0364945_0022998	All Organisms → cellular organisms → Bacteria → Proteobacteria	1648
3300034115|Ga0364945_0122456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	771
3300034164|Ga0364940_0103819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	801
3300034176|Ga0364931_0088690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	970
3300034692|Ga0373917_0019356	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	898
3300034894|Ga0373916_0015780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum → Aromatoleum aromaticum EbN1	903

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.74%
Host-Associated	Host-Associated	16.89%
Engineered	Engineered	1.37%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.97%
Aquatic	Environmental → Aquatic	28.77%
Plants	Host-Associated → Plants	16.89%
Bioremediation	Engineered → Bioremediation	0.91%
Solid Waste	Engineered → Solid Waste	0.46%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	47.49%
Sediment	Environmental → Aquatic → Sediment	18.72%
Rhizosphere	Host-Associated → Plants → Rhizosphere	10.50%
Freshwater	Environmental → Aquatic → Freshwater	7.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.94%
Floodplain	Environmental → Terrestrial → Floodplain	3.65%
Marine	Environmental → Aquatic → Marine	1.37%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.91%
Cave	Environmental → Terrestrial → Cave	0.91%
Metal	Engineered → Bioremediation → Metal	0.91%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.46%
Peat	Environmental → Terrestrial → Peat	0.46%
Roots	Host-Associated → Plants → Roots	0.46%
Grass	Engineered → Solid Waste → Grass	0.46%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.62%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	18.72%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.05%
Sediment	Environmental → Aquatic → Freshwater → Sediment	7.31%
Loam	Environmental → Terrestrial → Soil → Loam	5.94%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.94%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.65%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	3.65%
Sand	Environmental → Terrestrial → Soil → Sand	2.28%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.91%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.91%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	0.91%
Lake	Environmental → Aquatic → Freshwater → Lake	0.46%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.46%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.46%
Sediment	Environmental → Aquatic → Marine → Sediment	0.46%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.46%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.46%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.46%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.46%
Composting	Engineered → Solid Waste → Grass → Composting	0.46%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.92%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	18.72%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.05%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	7.31%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.94%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.48%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.11%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.65%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.65%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	3.65%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.83%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.37%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.37%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	1.37%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.91%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.91%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.91%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	0.91%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.46%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.46%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.46%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.46%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.46%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.46%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.46%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.46%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.46%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	15.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.05%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.31%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.39%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	5.48%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	5.02%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	3.65%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.74%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	2.74%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.74%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.28%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.28%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.37%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.37%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.37%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.37%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.37%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.37%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.37%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	1.37%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	0.91%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.91%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.91%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.91%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	0.91%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.46%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.46%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.46%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.46%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.46%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.46%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.46%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.46%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.46%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.46%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.46%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.46%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.46%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.46%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.46%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.46%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated
3300005890	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104	Environmental
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental
3300009037	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015	Environmental
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009153	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015	Environmental
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental
3300009444	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3	Environmental
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental
3300009796	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_0_10	Environmental
3300009806	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60	Environmental
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental
3300011395	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2	Environmental
3300011402	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2	Environmental
3300011432	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2	Environmental
3300011433	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2	Environmental
3300011437	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2	Environmental
3300011438	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2	Environmental
3300011439	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2	Environmental
3300011445	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2	Environmental
3300012034	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2	Environmental
3300012039	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2	Environmental
3300012040	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2	Environmental
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental
3300012142	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT499_2	Environmental
3300012161	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2	Environmental
3300012166	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2	Environmental
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental
3300012225	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2	Environmental
3300012227	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2	Environmental
3300012232	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2	Environmental
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental
3300012673	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT399_2	Environmental
3300012675	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2	Environmental
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012910	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2	Environmental
3300012913	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2	Environmental
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental
3300014259	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1	Environmental
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014867	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D	Environmental
3300014868	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D	Environmental
3300014870	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D	Environmental
3300014871	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da	Environmental
3300014885	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D	Environmental
3300015248	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10D	Environmental
3300015249	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293A_16_10D	Environmental
3300015252	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D	Environmental
3300015253	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10D	Environmental
3300015254	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D	Environmental
3300015256	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D	Environmental
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017999	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG	Environmental
3300018055	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex	Environmental
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental
3300018070	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1	Environmental
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental
3300019212	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome)	Environmental
3300020146	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C	Environmental
3300020202	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10	Environmental
3300021063	Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4	Environmental
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental
3300021264	Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Cave_1	Environmental
3300022204	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1	Environmental
3300022563	OV2_combined assembly	Environmental
3300023066	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6	Environmental
3300025001	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes)	Environmental
3300025155	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4	Environmental
3300025167	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)	Environmental
3300025318	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1	Environmental
3300025327	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)	Environmental
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated
3300026047	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd (SPAdes)	Environmental
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental
3300027326	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)	Environmental
3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)	Host-Associated
3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes)	Host-Associated
3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)	Host-Associated
3300027573	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)	Environmental
3300027639	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)	Environmental
3300027650	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq	Environmental
3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)	Host-Associated
3300027731	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)	Environmental
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300027955	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental
3300028420	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)	Environmental
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300028812	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48	Environmental
3300030606	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125	Environmental
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental
3300030620	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111	Environmental
3300031228	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57	Environmental
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated
3300031576	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25	Environmental
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental
3300033407	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175	Environmental
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental
3300033805	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10	Environmental
3300033811	Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17	Environmental
3300033815	Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17	Environmental
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental
3300034164	Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17	Environmental
3300034176	Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17	Environmental
3300034692	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3	Engineered
3300034894	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2	Engineered

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
NODE_05158372	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MDATLLVARILDRMDFRPEVIGAQEIVRDPQPSGRVAF*
JGI11643J12802_110283433	3300000890	Soil	MQVPLVLAGFLDRMDFRAQVVGAQEIVRDPQPSGRIAL*
JGI11615J12901_104931002	3300000953	Soil	VKAALAIARLLDRMDLRPQVVGAKKVVGDSQSACGVSF*
Ga0055490_101724812	3300004052	Natural And Restored Wetlands	RRHQRRMQRELGVAGLVDRMDLRPQVVGAQEVVGDPQPAGRVAR*
Ga0063356_1046237271	3300004463	Arabidopsis Thaliana Rhizosphere	RRVDAPLALAGFLDRVDFRAQVVCAQEIVGHAQPAGCVAF*
Ga0070689_1000723631	3300005340	Switchgrass Rhizosphere	PMQAPLGVTRLLDRMDFRAQVIGAQEIVGDPQSSRGVSF*
Ga0070700_1002459863	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	FHERRVQAPLGVTRFLDRMDLRAQVVRAQEIVGDPQPAGRVAF*
Ga0066699_102824102	3300005561	Soil	MQFAFVDARLLDRMDLGPQVIGAQEIVGDPQPAGGVAL*
Ga0068857_1016220672	3300005577	Corn Rhizosphere	VQAPLGVARLLDRMDLRPQVVGAQEIVGDPQPAGRVAL*
Ga0066905_1006885311	3300005713	Tropical Forest Soil	HQRGMDATLLVARLLDRVDLRPEVVGAQEIVRDPQPSGRVAF*
Ga0068861_1000492754	3300005719	Switchgrass Rhizosphere	VQAPLGVTRFLDRMDLRAQVVRAQEIVGDPQPAGRVAF*
Ga0074479_100819272	3300005829	Sediment (Intertidal)	VQVEFGRAGFFDRMDLRAQVIRAQEVVGYPEPAGRVAF*
Ga0068862_1006213222	3300005844	Switchgrass Rhizosphere	MQAPLGITRFLDRMDFRAQVVRAQEIVGDPQPAGRVAF*
Ga0075285_10363502	3300005890	Rice Paddy Soil	VERSLARAGFLDRMDLGAQVVGTQKVVGDPQPPGRVTL*
Ga0066652_1005423912	3300006046	Soil	VQFALGNARLLDRVDLRAQVIGAQEIVGDPQPAGGVAL*
Ga0075421_1004645053	3300006845	Populus Rhizosphere	VQSKLALAGFLDRVDLRAQVVGAQEVVGDPQAARGISF*
Ga0075421_1014208102	3300006845	Populus Rhizosphere	MQRVLARPRLLDRMDLRPQVIRAQEIVGDPQPSRGVSF*
Ga0075430_1000266825	3300006846	Populus Rhizosphere	VQSTLALAGLLDRVDLRAQVVGAQEVVGDPQAARGISF*
Ga0075430_1003588172	3300006846	Populus Rhizosphere	MQTQLRIARLLDRVDLRPQVIGAQEIVGDPQPAGRIAF*
Ga0075431_1015505812	3300006847	Populus Rhizosphere	VKLQLGVARLLDRMDLRAQVIRAQEVVGDPQPPGGVSF*
Ga0079217_105545172	3300006876	Agricultural Soil	MKAKLAFPRFLDRMDLRAQVIGAQEVVGDPQAPRRVPF*
Ga0079217_106099922	3300006876	Agricultural Soil	MKPELALAGFLDRVDLRPQVVGAQEIVGDPQPAGRVAF*
Ga0079217_113681052	3300006876	Agricultural Soil	VNGKLVFAGFVDRVDLRAQVVGAEEIVRDPQASCGVAF*
Ga0079217_113796782	3300006876	Agricultural Soil	CWMFHQRRMQPPLAVARLLDRVNFRPQVVRAQEVVGDPQAPRGVSF*
Ga0075429_1005259711	3300006880	Populus Rhizosphere	HERRVDAPLALAGFLDRVDFRAQVVCAQEIVGHAQPAGCVAF*
Ga0079215_100245662	3300006894	Agricultural Soil	MQPALAVARLLDRMDFRAQVVGAQKIVGDPQAACRVSF*
Ga0079215_109032842	3300006894	Agricultural Soil	MKLALALARFFDRMDLRPQVVGAQKVVADPQPAGRVAL*
Ga0079216_116590762	3300006918	Agricultural Soil	MQSELVFAGVVDRVDLRAQVVGAEEIVRDPQASCGVAF*
Ga0079218_110913732	3300007004	Agricultural Soil	MQGELACARFLDRMDLGAQVVGAQEVVRDAQPARRVAL*
Ga0079218_111419472	3300007004	Agricultural Soil	MKAKLAFPRLLDRMDLRAQVIGAQEVVGDPQAARGVPF*
Ga0079218_138528332	3300007004	Agricultural Soil	MKVKLSFPRLLDRVDLRPQVIGAQEIVGDPQPAGRIAF*
Ga0105093_100981372	3300009037	Freshwater Sediment	MQGKLAFAGFLDRMDLRAQVVGAQEIVRDPQASCGVAF*
Ga0099829_105339552	3300009038	Vadose Zone Soil	MQPQLRAARLLDRVDLGPQVIRAQEIVRDPQPAGGIAF*
Ga0099829_116173892	3300009038	Vadose Zone Soil	MQSQLGIARLLDRVDLGPQVIRAQEIISDPQPAGGVAF*
Ga0105095_1000199313	3300009053	Freshwater Sediment	MQPQLGVAGLLDRVDLRAQVVGAQEVVGDPQPAGGVAL*
Ga0105095_101824672	3300009053	Freshwater Sediment	MKRELAFARLLDRMDLRAQVVRAQKVVRDPQPAGGVAF*
Ga0105106_100292792	3300009078	Freshwater Sediment	MKRDLVLARLLHRMDLRAQVVGAQEVVGDPQAARGVAL*
Ga0105106_101769653	3300009078	Freshwater Sediment	MKRELAFARLLDRMDLRAQVVRAQKVVRDPQPAGRVAL*
Ga0105106_102762342	3300009078	Freshwater Sediment	MQSELALARFLDRMDLRAQEVGAQEIVGDPQPACGVAF*
Ga0105099_100907752	3300009082	Freshwater Sediment	MQGALAFARLLHRMDLGAQVVGAQEIVRDPQASCGVAF*
Ga0099828_101374952	3300009089	Vadose Zone Soil	MQSQLGIARLLDRLDLGPQVVRAQEIVRDPQPAGGIAF*
Ga0111539_133932542	3300009094	Populus Rhizosphere	VQAPLRVARFLDGMDFRAQVIRAQEIVGDPQPAGRISF*
Ga0066709_1002659352	3300009137	Grasslands Soil	VQFALGNARLLDRVDLRAQVIGAQEIVGDPQPAGRVAL*
Ga0114129_102671994	3300009147	Populus Rhizosphere	VEFALGDARFLDRMDLGPQVVGAQEIVGDPQLAGGVAL*
Ga0114129_130880562	3300009147	Populus Rhizosphere	MQLALGRTGLLYRMDLRAQVVRAQEVVGDPQPPGRVAF*
Ga0105094_106549091	3300009153	Freshwater Sediment	MKRELAFARLLDRMDLRAQVVRAQKVVRDPQPAGRVAF*
Ga0111538_100450064	3300009156	Populus Rhizosphere	VQAPLRVARFLDRMDFRAQVIRAQEIVGDPQPAGRISF*
Ga0111538_111444892	3300009156	Populus Rhizosphere	MQVPLVLAGFLDRMDFRAQVVGAQEIVRDPQPAGRVAL*
Ga0105092_100518762	3300009157	Freshwater Sediment	MQAPLGHARFLDRVKLRAQVVGAQEVVGDPKFSGRVAF*
Ga0114945_100241474	3300009444	Thermal Springs	MFHERGVQPALGLAGFLDRVDLRAQVVGAQKIVADRQSSGRVAL*
Ga0105252_1000149914	3300009678	Soil	VQVAFGRAGLFDRMDLRAQVIRAQEVVGDPQPAGRVAF*
Ga0105086_1071302	3300009796	Groundwater Sand	FHQRRMQAPLGVTRLFDRMDFRAQIVRAQEIVGDPQSSRGVSF*
Ga0105081_10295432	3300009806	Groundwater Sand	MQPPLGVARLLDRMDLRPQVVGAQEVVGDPQPSGGVPLQ*
Ga0099796_100972262	3300010159	Vadose Zone Soil	VKRPLGVVRFLDRMDFRAQVVGAQEIVGDPQPSGRVLL*
Ga0134063_107623552	3300010335	Grasslands Soil	RLHELCVQGELGVAGFLHRVDFRAQVVGAQEIVRDAQASGRVAL*
Ga0134125_118484612	3300010371	Terrestrial Soil	MQAPLRVTRFLDRMDFRAQVIGAQEIVRDPQPAGRVAL*
Ga0136847_125906192	3300010391	Freshwater Sediment	MQTKLGVARLLDRVDLGPQVVGAQEIVRDPQPAGGVAF*
Ga0134127_100491362	3300010399	Terrestrial Soil	MDAALVVARLLDRMYLRPEEVGAQEVVGDPQPSGRISF*
Ga0134127_100545945	3300010399	Terrestrial Soil	MKPQLGCARLLDGMDLRPQVIGAQEVIRDPQPPGRVAF*
Ga0134127_131032362	3300010399	Terrestrial Soil	MQAPLVLAGFLDRMDFRAQVVGAQEIVRDPQPSGRIAL*
Ga0134121_117146492	3300010401	Terrestrial Soil	MQAPFGIVRFLDRVQFRPQVVGAQEIVRDPQPAGRVAL*
Ga0134123_108813942	3300010403	Terrestrial Soil	MQAPLGVTRLLDRMDFRAQVIGAQEIVGDPQSSRGVSF*
Ga0105246_105139683	3300011119	Miscanthus Rhizosphere	MDPALVVAGLLDRMQLRAQKVGPQEIVRDPQPPGRVAF*
Ga0137392_101787054	3300011269	Vadose Zone Soil	MQPQLGAARLLDRVDLGPQVIRAQEIVRDPQPAGGVAF*
Ga0137315_10029682	3300011395	Soil	VQAQFGVAGLFDRMDLRAQIVGAQEIVGDPQPAGRIAF*
Ga0137356_10173612	3300011402	Soil	VQAQFSVAGLFDRMDLRAQAIGAQEIIGDPQPAGRVAF*
Ga0137428_10070574	3300011432	Soil	MKPALGVAGFLDRMDLRSQAIGAQEVVGNPQPARRVFL*
Ga0137443_10693841	3300011433	Soil	QGRVKPDLGVARLLDRMDLRPQVIRAQEVVGDPQPAGRVAL*
Ga0137429_10538302	3300011437	Soil	VQAQFGVAGLFDRMDLRAQVIRAQEVVGDPQPAGRVAF*
Ga0137451_10355332	3300011438	Soil	VQAEFGIAGLFERMDLRAQVVGAQEIVGDPQPAGRVAF*
Ga0137432_10320712	3300011439	Soil	VQAQFGVAGLFDRMDLRAQVIRAQEIVGDPQPAGRVAF*
Ga0137427_100888773	3300011445	Soil	QAQLRVAGFLDRVDLRAQEVGAQEIVGDSQPAGRVAF*
Ga0137453_10221822	3300012034	Soil	MQAQLRVAGFLDRVDLRAQEVGAQEIVGDSQPAGRVAF*
Ga0137421_10603032	3300012039	Soil	VHERSVQAEFGIAGLFERMDLRAQVVGAQEIVGDPQPAGRVAF*
Ga0137461_11171562	3300012040	Soil	RVQAQLGFARFLDRMHLRPEVVGAQEVVGDPQPAGRVAL*
Ga0137389_107596391	3300012096	Vadose Zone Soil	PQLRAARLLDRVDLGPQVIRAQEIVRDPQPAGGVAF*
Ga0137343_100001519	3300012142	Soil	AQLGFARFLDRMHLRPEVVGAQEVVGDPQASRGISF*
Ga0137343_10282941	3300012142	Soil	GLVKLPLRVAGLLHRMHLRAQVIRAQEIVGDPQPAGGVSF*
Ga0137336_10092003	3300012161	Soil	VQVAFGRAGLFDRMDLRAQVIRAQEVVGDPQPAGRIAF*
Ga0137350_10316892	3300012166	Soil	MQAQLRVAGFLDRVDLRAQEVGAQEVVGDSQPAGRVAF*
Ga0137380_100161142	3300012206	Vadose Zone Soil	MQPQLGIARLLDRVDLGPQVIRAQEIVRDPQAAGGVAF*
Ga0137381_100275095	3300012207	Vadose Zone Soil	MQSQFGIARLLDRVDLGPQIVRAQEIVRDPQPAGGVAF*
Ga0137434_10224682	3300012225	Soil	VQAQFGVAGFLDRVDFRAQAVGAQEIVGDPQPAGRVAF*
Ga0137449_10003744	3300012227	Soil	MQAQLRVAGFLDRVDLRAQEVGAQEIVGDPQPAGRVAF*
Ga0137449_10826042	3300012227	Soil	VQTEFGIAGLFERMDLRAQVVGAQEIVGDPQPAGRVAF*
Ga0137435_10492483	3300012232	Soil	VQPDLGVARFLDRVDLRPQVIGAQEVVGDPQPAGGVAF*
Ga0137435_11217742	3300012232	Soil	VNAALLVAGLFDRVHLRPEVVRPQEIVADPQPAGRVAF*
Ga0137375_100510655	3300012360	Vadose Zone Soil	MQSQLGIARLLDRVDLGPQIVRAQEIVRDPQPAGGVAF*
Ga0137339_10024852	3300012673	Soil	VQAEFGVAGLFERMDLRAQIVGAQEIVGDPQPAGRVAF*
Ga0137337_10086243	3300012675	Soil	VQAQFGVAGLFDRMDLRAQGVGAQEIVGDPQPAGRVAF*
Ga0137397_110411492	3300012685	Vadose Zone Soil	VEAQLAFARLVDRVNFRPQVVGPQEVVGDPQPSGRVAF*
Ga0157308_100733932	3300012910	Soil	MQLELALARFLDRMDLRAQVVRAQEVVGDPQPAGRVAF*
Ga0157298_100362642	3300012913	Soil	MQAPLGVTRLLDRMDFRAQVVGAQEIVGDPQPAGRVAF*
Ga0137395_105492572	3300012917	Vadose Zone Soil	MHQGGVKGPLCIVGLLDRMDFRAQVVGAQEIVGDPQPSGRVLL*
Ga0137394_103908452	3300012922	Vadose Zone Soil	MQRALGIAGILDRMDLRPQVIRAQEIVGDPQPAGRVAF*
Ga0137413_110175861	3300012924	Vadose Zone Soil	PGGIHQCRVKRPLGVVRFLDRMDFRAQVVGAQEIVGDPQPSGRVFL*
Ga0164309_117531622	3300012984	Soil	PGVLHQGRVNATFLVARLLDRMHLWPEVVRAQEIIADQQPAGRVAF*
Ga0075311_10166635	3300014259	Natural And Restored Wetlands	CHQRSMKRELARARLLHRKHLGAQVVGAQEIVGDPQPAGRVAL*
Ga0075342_11003642	3300014320	Natural And Restored Wetlands	PLGVAGFLDRVDLRAQVVGAQEVVGDPQPAGRVAR*
Ga0157380_102133504	3300014326	Switchgrass Rhizosphere	VQAPLGVTRFLDRMDLRAQVVRAQEIVGDPQPVCRVAF*
Ga0180076_10726902	3300014867	Soil	VQVPLGVAGLLDRMDLRAQIVGAQEIVGDPQPAGRVAF*
Ga0180088_10221502	3300014868	Soil	VKPDLGVARLLDRMDLRPQVIRAQEVVGDPQPAGGVFL*
Ga0180080_10318082	3300014870	Soil	VQAEFGVAGLFERMDLRAQVVGAQEIVGDPQPAGRVAF*
Ga0180095_10019104	3300014871	Soil	VQPPLGIARLLDRVDLRPQVVGAQEIVGDPEPAGGIPL*
Ga0180063_11056982	3300014885	Soil	MQPALGVAGFLDRMDLRSQAIGAQEVVGNPQPARRVFL*
Ga0180079_10206072	3300015248	Soil	MQRALGVAGFLDRVDLRAQVVGAQEIVGDPQPAGRVAF*
Ga0180071_10491212	3300015249	Soil	MQAQFVFAGFLDRVDFRPQVVGAQEIVGDPQPAGRVAF*
Ga0180075_10017162	3300015252	Soil	VQAQFGVAGLFERMDLRAQIVGAQEIVGDPQPAGRVAF*
Ga0180081_10108422	3300015253	Soil	VQAEFGVAGLFERMDLRAQIVGAQEIVGDPQPAGRIAF*
Ga0180089_10102503	3300015254	Soil	VQAQFGVTGLFDRMDLRAQGVGAQEIVGDPQPAGRVAF*
Ga0180073_11480072	3300015256	Soil	VQAQFGVAGLFDRMDLRAQGVGAQEIVGDPEPAGGIPL*
Ga0163161_105740102	3300017792	Switchgrass Rhizosphere	SLGWAIVQAPLGVTRFLDRMDLRAQVVRAQEIVGDPQPVCRVAF
Ga0187767_102491672	3300017999	Tropical Peatland	MQSDFGVARLLDRMDLRPQVVGAQEVVRDAQAPGRVAL
Ga0184616_100284054	3300018055	Groundwater Sediment	MQAEFGVAGLLDRMDLRAQIVGAQEIVGDPQPAGRVAF
Ga0184637_105715602	3300018063	Groundwater Sediment	MQAQLGVAGFLYRVDLRAQVVGAQEIVGDPQPAGRVAF
Ga0184631_100082362	3300018070	Groundwater Sediment	MQAEFGVAGLLDRMDLRAQGVGAQEIVGDPQPAGRVAF
Ga0184612_105369561	3300018078	Groundwater Sediment	RLHKRGMQPQLGIARLLGRVNLGPQVIRAQEIVRDPQPAGGVAF
Ga0184628_1000212312	3300018083	Groundwater Sediment	MQAQLRVAGFLDRVDLRAQEVGAQEIVGDSQPAGRVAF
Ga0187774_100155635	3300018089	Tropical Peatland	ERTLGTARLLDWMHLGPQVVGAQKIVRDPQVARGVTL
Ga0190265_100564453	3300018422	Soil	MQRALPLARLLDRMDLRAQVVGAQEIVGDPQPAGRVAF
Ga0190265_100720774	3300018422	Soil	MQSELALAGFLDRMDLRAQVIGAEEIVRDPQASCGVAF
Ga0190265_101144373	3300018422	Soil	MEVELPFPRLLNRMDLRAQVIRAQKVVGDPQAARGVPF
Ga0190265_102471143	3300018422	Soil	VQGELALARLLDRVQLGAQEVRPQEIVRDPQPAGRVAL
Ga0190265_129789282	3300018422	Soil	MQAQLGVARLLDRMDLGPQVVRAQEIVGDPKPSRRVFL
Ga0190272_101699062	3300018429	Soil	MKPPLALARLLDRMDLRAKVVGAQEIVGDPQSPCGVSF
Ga0190272_121236412	3300018429	Soil	MKAKLAFARLLDRMDLRAQVVGAQEVVGDPQPAGGIPL
Ga0190275_105903272	3300018432	Soil	VHAALAIARLLDRMDLRAQVISAQEVVGDPQPAGRIPF
Ga0190275_110000242	3300018432	Soil	VHAALAIAGLLDRMDLRAQVISAQEVVGDPQPAGRIPF
Ga0190275_116106812	3300018432	Soil	MEAKLALARLLDRMDLRAQVVRAQEVVGDPQPACGVAR
Ga0180106_10142692	3300019212	Groundwater Sediment	QVEFGLAGLSDRMDLRTQVIRAQEVVSYPQPAGRVAF
Ga0196977_10216193	3300020146	Soil	MQAALSLARFLDRVDLRAQVVRAQKIVRDPQAARGVSF
Ga0196964_100032956	3300020202	Soil	VDAALAFGRFLDRVDLRAQVVRAQEIVGDPQPAGCVAF
Ga0196964_101906102	3300020202	Soil	VDAPLVVARFLDRMDFRAQQVRAQEIVRDPQPAGGIAF
Ga0206227_10021553	3300021063	Deep Subsurface Sediment	VQAALGLAGFLDRMDLRAQVIRAQEVVGDPQPAGRVAF
Ga0210380_100026475	3300021082	Groundwater Sediment	MQAQLRVAGFLDRVDLRAQEVGAQEIVGDPQPAGRVAF
Ga0210380_104478992	3300021082	Groundwater Sediment	VDAHLVLARLLDRMDLRAEEVGAEEIVGDPQPAGGVAF
Ga0210377_105273432	3300021090	Groundwater Sediment	VQAQFGVAGLLDRMDLRAQGVGAQEIVGDPQPAGRVAF
Ga0213895_1000402	3300021264	Soil	MKVKLSFPRLLDRVDLRPQVIGAQEIVGDPQPAGRIAF
Ga0224496_100661493	3300022204	Sediment	MQPQLGVAGLLDRVDLRPQVVGAQEVVGDPQPAGRVTL
Ga0212128_100401154	3300022563	Thermal Springs	MFHERGVQPALGLAGFLDRVDLRAQVVGAQKIVADRQSSGRVAL
Ga0247793_10512252	3300023066	Soil	VQAPLGVARLLDRMDLRPQVVGAQEIVGDPQPAGRVAL
Ga0209618_10364932	3300025001	Soil	MQAKLALAGFLDGVEFRPQVVRAQEVVRDPQPPGRVAF
Ga0209320_100822432	3300025155	Soil	MQGKLAFAGFLDRMDLRAQVVGAQEIVRDPQASCGVAF
Ga0209642_101019654	3300025167	Soil	RRFHQRRVQAQLGVARLFDRMDLRPQIVGAQEVVGDPQPAGWIAL
Ga0209519_107298752	3300025318	Soil	MQGELALARFLDRMDLGPQVVGAQEIVRDPQPAGRVAL
Ga0209751_101951112	3300025327	Soil	MQSELALAGFLDGVDLRAQVVGAQEIVRDPQASCGVAF
Ga0207653_101290633	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	RRVQAPLRVARLLDRMDFRAQVIRAQEIVGDPQPAGRVAC
Ga0207692_100562201	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	GFHQFGVQAQLGLARLLDRMQLRPQVVRPQEIVRDPQPAGRVAL
Ga0207688_100813342	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	VQAPLGVTRFLDRMDLRAQVVRAQEIVGDPQPAGRVAF
Ga0207660_100241384	3300025917	Corn Rhizosphere	VQAPLGVTRFLDRMDLRAQVVRAQEIVGDPQPVCRVAF
Ga0207660_100972372	3300025917	Corn Rhizosphere	MKPQLGGARLLDRMDLRPQVIGAQEVVGDPQPPGRVAF
Ga0207660_110450522	3300025917	Corn Rhizosphere	MQPALAVARLLDRVDLRAQVVGAQEIVGDPQSSRGIAF
Ga0207662_100630942	3300025918	Switchgrass Rhizosphere	MQAPLGVTRLLDRMDFRAQVIGAQEIVGDPQSSRGVSF
Ga0207662_102971282	3300025918	Switchgrass Rhizosphere	MDPAFVVAGLFDRMQLRAQKVGPQEIVRDPQPPGRVAF
Ga0207704_109571872	3300025938	Miscanthus Rhizosphere	MQAPLRVTRFLDRMDFRAQVIGAQEIVRDPQPAGRVAL
Ga0207651_103175943	3300025960	Switchgrass Rhizosphere	MDPAFVVAGLLDRMQLRAQKVGPQEIVRDPQPPGRVAF
Ga0208658_10118012	3300026047	Natural And Restored Wetlands	VQVEFGRAGFFDRMDLRAQVIRAQEVVGYPEPAGRVAF
Ga0207674_116870562	3300026116	Corn Rhizosphere	MQLELALARFLDRMDLRAQVVRAQEIVGDPQPAGRVAF
Ga0209131_10597653	3300026320	Grasslands Soil	VQVPLGLARLLDRMNLGPQVVGAQEVVADPEQAGGVAF
Ga0209131_11363442	3300026320	Grasslands Soil	MDAALVVARFLDRMDLRPQVVGAQEIVRDPQPAGRIAF
Ga0209805_10890992	3300026542	Soil	MQFAFVDARLLDRMDLGPQVIGAQEIVGDPQPAGGVAL
Ga0209731_10517942	3300027326	Forest Soil	VQAQLALARFLDRMDLRPQVVGAQEVVGDPQAARGVSF
Ga0209969_10059872	3300027360	Arabidopsis Thaliana Rhizosphere	MQGKLACAGFLDRMDLRSQVIGAQEIVRDPQASCGVAF
Ga0209969_10462382	3300027360	Arabidopsis Thaliana Rhizosphere	MQVPLVLAGFLDRMDFRAQVVGAQEIVRDPQPSGRIAL
Ga0209981_10550512	3300027378	Arabidopsis Thaliana Rhizosphere	MEVQLPFPRFLDRMDLRAQVIGAQEVVGDPQAARGVPF
Ga0209996_10044392	3300027395	Arabidopsis Thaliana Rhizosphere	MQGKLAGAGFLDRMDLRSQVIGAQEIVRDPQASCGVAF
Ga0208454_10113652	3300027573	Soil	VQVAFGRAGLFDRMDLRAQVIRAQEVVGDPQPAGRVAF
Ga0209387_10550472	3300027639	Agricultural Soil	MQPALAVARLLDRMDFRAQVVGAQKIVGDPQAACRVSF
Ga0256866_11718262	3300027650	Soil	MQGELALARLLDRVDLGAQAVRAQEIVGDSQPAGRVAL
Ga0209998_101360842	3300027717	Arabidopsis Thaliana Rhizosphere	MQGKLACAGFLDRMDFRAQVVGAQEIVRDPQPSGRIAL
Ga0209592_10097865	3300027731	Freshwater Sediment	MQPQLGVAGLLDRVDLRAQVIGAQEVVGDPQPAGGVAL
Ga0209592_12171942	3300027731	Freshwater Sediment	MKRELAFARLLDRMDLRAQVVRAQKVVRDPQPAGRVAL
Ga0209180_107627492	3300027846	Vadose Zone Soil	KLLIGNRSSWRLHQRGMQPQLRAARLLDRVDLGPQVIRAQEIISDPQPAGGVAF
Ga0209283_100213665	3300027875	Vadose Zone Soil	MQSQLGIARLLDRLDLGPQVVRAQEIVRDPQPAGGIAF
Ga0209283_102077152	3300027875	Vadose Zone Soil	MQSQLGIARLLDRVDLGPQVIRAQEIISDPQPAGGVAF
Ga0207428_104246462	3300027907	Populus Rhizosphere	VQAPLRVARFLDGMDFRAQVIRAQEIVGDPQPAGRISF
Ga0207428_112438932	3300027907	Populus Rhizosphere	MQAPLGITRFLDRMDFRAQVVRAQEIVGDPQPAGRVAF
Ga0209382_102285092	3300027909	Populus Rhizosphere	VQSKLALAGFLDRVDLRAQVVGAQEVVGDPQAARGISF
Ga0209078_11158851	3300027955	Freshwater Sediment	ELAFARLLDRMDLRAQVVRAQKVVRDPQPAGRVAF
Ga0210366_100567782	3300028420	Estuarine	MQPQLGIAGLLDRMDLRAQVVGAQEVVGDPQPAGRVAL
Ga0307503_101177311	3300028802	Soil	VDAPLVVAGLLDGMHFRPKVVGAEEIVADPQPAGGVAF
Ga0247825_100969052	3300028812	Soil	MQTQIRIARLLDRVDLRPQVIGAQEIVGDPQPAGRIAF
Ga0299906_101670422	3300030606	Soil	MQGELAFARFLDRVDLRAQVVGAQEIVGDPQAACGIAF
Ga0268386_100153595	3300030619	Soil	MQGELALAGFLDGMDLRAQVIGAQEIVRDPQASCGVAF
Ga0268386_102043732	3300030619	Soil	MQGELALARRLDRVDLGAQAVRAQEIVGDSQPAGRVAL
Ga0302046_101815712	3300030620	Soil	MQSELALARFLDRMDLRAQEVGTQEIVGDPQPACGVAF
Ga0302046_110410112	3300030620	Soil	MQGELAFARFLDRVDLRAQVVGAQEIIGDPQAACGIAF
Ga0299914_112630471	3300031228	Soil	SMQGALALARLLHRMDLGAQVVGAQEIVRDPQPAGRVAL
Ga0299913_110479902	3300031229	Soil	MKRELALARLLDRVQLGAQEVRPQEIVGDPQPAGRVAL
Ga0307509_108230081	3300031507	Ectomycorrhiza	RGLHKGCMQGALAVSRFLDRMDLGPQVVGAQKIVRDAQASGRVPL
Ga0307408_1003297682	3300031548	Rhizosphere	VDATLFVARLLDRMNLRPEEVGAQEVVGDPQPSGRISF
Ga0307408_1005570602	3300031548	Rhizosphere	MQAHLGLAGLLDWVNLRAQVIRAQEIVGDPQPAGRVAL
Ga0247727_1000935613	3300031576	Biofilm	VQAQFAIAGLFDRMDLRAQGVGAQEIVGDPQPAGRVAF
Ga0247727_102040143	3300031576	Biofilm	MQPQLAVARLLDRMELGPQVVGAQEIVADPQPSGRVAL
Ga0307412_101232452	3300031911	Rhizosphere	MQAHLGLAGLLDWMNLRAQVIRAQEIVGDPQPAGRVAL
Ga0310884_103609182	3300031944	Soil	VRHERGVQAPLRIARLLDRMDLRPQVIRAQEIVGDPQPAGRIAF
Ga0310903_102853322	3300032000	Soil	MQLELALARFLDRMDLRAQVVRAQEVVGDPQPAGRVAF
Ga0307416_1002681853	3300032002	Rhizosphere	MEVKLTFARLLDRMDLRAQVVGAQEVVGDPQAARGVSF
Ga0310897_100271624	3300032003	Soil	RVQAPLGVTRFLDRMDLRAQVVRAQEIVGDPQSSRGVSF
Ga0307411_113478482	3300032005	Rhizosphere	RMQAHLGLAGLLDWVNLRAQVIRAQEIVGDPQPAGRVAL
Ga0307415_1004939362	3300032126	Rhizosphere	MQAHLGLAGLLDWVNLRAQVIRAQEVVGDPQPAGRVAL
Ga0315912_115290222	3300032157	Soil	MQAALALARLLERMDLRAQVVRAQEIVGDPQAARGVSY
Ga0307471_1010444502	3300032180	Hardwood Forest Soil	MQSQLGIARLLDRVDLGPQVIRAQEIVRDPQPAGGVAF
Ga0307471_1027456442	3300032180	Hardwood Forest Soil	MQPALAIARLLDRMDLRPQVIGAQEVVGDLQPACSVSF
Ga0307472_1000595154	3300032205	Hardwood Forest Soil	VQGTLGVVGFLDRMDLRAQVIRAQEVVGDPQPASRVAL
Ga0335070_102512033	3300032829	Soil	MQATLGIARFLDRMHLRPQVVGAQEIVRDPQVACGVAL
Ga0214472_102074593	3300033407	Soil	MKPPLGIARFLDRMDLRAQVIGAQEVVGDRQPPGRIPL
Ga0326726_121346672	3300033433	Peat Soil	GHQRRMHFPLGVVGLLDRVHLRPQVVGAQEIVGDPQPAGRVAL
Ga0314864_0093395_494_610	3300033805	Peatland	VDAALDLARFLDRMDLRPQEIGAQEIVGDAQPAGRVAR
Ga0364924_011421_138_254	3300033811	Sediment	VQAQFGVAGLFERMDLRAQVVGAQEIVRDPQPAGRVAF
Ga0364924_030741_859_975	3300033811	Sediment	MQAQFIFAGFLDRVDLRAQVIGAQEIVGDPQPAGRVAF
Ga0364924_145082_435_551	3300033811	Sediment	VQAQFGVAGLFDRMDLRAQIVGAQEIVGDPQPAGRVAF
Ga0364946_082806_346_462	3300033815	Sediment	MQAEFGVAGLFDRMDLRAQIVGAQEIVGDPQPAGRIAF
Ga0364945_0022998_1528_1644	3300034115	Sediment	VNAALVVAGLFDRVHLRPEVIRPQEIVGDPQPAGRVAF
Ga0364945_0122456_485_601	3300034115	Sediment	MQAPLGVTRLLDRMNLRPQVVRAQEIVGDPQSSRGVSF
Ga0364940_0103819_651_767	3300034164	Sediment	MQPPLGIARLLDRMDLRPQVIGAQEIVGDPQPSGRVAL
Ga0364931_0088690_3_116	3300034176	Sediment	QAEFGVAGLIDRMDLRAQIVGAQEIVGDPQPAGRVAF
Ga0373917_0019356_277_393	3300034692	Sediment Slurry	MQAPLGHARFLDRVKLRAQIVGAQEVVGDPKFSGRVAF
Ga0373916_0015780_494_610	3300034894	Sediment Slurry	MQPQLALARLLDRMDLRAQIVGAQEVVGDSQPSGRVAL