| Basic Information | |
|---|---|
| Family ID | F020839 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 221 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AAAQTAPKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQANTNKN |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 221 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.07 % |
| % of genes near scaffold ends (potentially truncated) | 84.16 % |
| % of genes from short scaffolds (< 2000 bps) | 84.62 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.738 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (47.511 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.661 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (69.683 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.74 % |
| All Organisms | root | All Organisms | 2.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 47.51% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 15.38% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 10.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001225 | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 11_joined | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009971 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_174 metaG | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010263 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 16_60_3.3_214_A3 metaG | Engineered | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028149 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028246 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028465 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032843 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwM_1066231 | 3300001225 | Switchgrass Rhizosphere | PRTAPAAAQSAQKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN* |
| Ga0070666_113047561 | 3300005335 | Switchgrass Rhizosphere | AAQSARKTAAPGTGTPPKDQRLLTNTWPKQGTTISIQANTNKS* |
| Ga0070668_1012745001 | 3300005347 | Switchgrass Rhizosphere | AAPGTGTGAPQMDQRLLTNTWPKQCTKISIQANTNKTKKQYNNT* |
| Ga0070668_1012938942 | 3300005347 | Switchgrass Rhizosphere | QTAPKMAAPGTGTGAPQMDQRLLTNTWPKQSTIISIQANTNKN* |
| Ga0070668_1013431531 | 3300005347 | Switchgrass Rhizosphere | KTAAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKN* |
| Ga0070668_1016350281 | 3300005347 | Switchgrass Rhizosphere | PTAAQSGQKTAAPGTGTGAPPVAQRLLTSTRPKIRHTISIQANTNKS* |
| Ga0070668_1019697331 | 3300005347 | Switchgrass Rhizosphere | AAAQTAPKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQANTNKN* |
| Ga0070671_1007294952 | 3300005355 | Switchgrass Rhizosphere | ALAAAQSARKTAAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQTNINKN* |
| Ga0070671_1009245981 | 3300005355 | Switchgrass Rhizosphere | PAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKTIQNINIHANKS* |
| Ga0070671_1018041731 | 3300005355 | Switchgrass Rhizosphere | PRTAPAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQSTIISIQANTNKN* |
| Ga0070688_1013651561 | 3300005365 | Switchgrass Rhizosphere | SARKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN* |
| Ga0070688_1016151141 | 3300005365 | Switchgrass Rhizosphere | TAPAAAQTGQKTAAPGTGTGAPQMDQRLLTNTWPKTIHNINIQANKCKY* |
| Ga0070667_1011829711 | 3300005367 | Switchgrass Rhizosphere | TCLPRTALAAAQTAPKTAAPGTGTGAPQMDQRLLTNIWPKQSTIISIQANTNKN* |
| Ga0070667_1013894272 | 3300005367 | Switchgrass Rhizosphere | AQSARKTAAPGTGTGAPQMDQRLLTNTWPKQCTGISIQANTNKN* |
| Ga0070706_1013484611 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RKTAAPGTGTGAPQMDQRLLTNTWPKTIHNINIHANNRKN* |
| Ga0070707_1012101981 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQSTIISIQANTNKN* |
| Ga0070686_1015146201 | 3300005544 | Switchgrass Rhizosphere | RTAPAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQTNINKN* |
| Ga0070665_1010110302 | 3300005548 | Switchgrass Rhizosphere | QKTAAPGTGTGAPPVAQRLLTNTWPKTIHNINIQANTNKS* |
| Ga0070704_1012835192 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RTAPAAAQTGQKTAAPGTGTGAPPVAQRLLTNTWPKRGTTISIQANNNKS* |
| Ga0070704_1019012871 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KTAAPGTGTEAPQMDQRLLTNTWPKQCTGISIQANTNKN* |
| Ga0070704_1021269511 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAAQTAPKTAAPGTGTGAPQMDQRLLTNTWPKQCTTISIQANTNKS* |
| Ga0070702_1009347172 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ALAAAQTDPKTAAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKN* |
| Ga0070702_1012752832 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | APKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTSKN* |
| Ga0068864_1025954872 | 3300005618 | Switchgrass Rhizosphere | APGTGTGAPQMDQRLLTNTWPKQCTIISIQENTNKN* |
| Ga0068861_1016797552 | 3300005719 | Switchgrass Rhizosphere | AAPGTGTGAPQMDQRLLTNTWPKQCTVISIQANTNKN* |
| Ga0068863_1004578481 | 3300005841 | Switchgrass Rhizosphere | PRTAPATAQTGQKTAAPGTGTGASPVAQRLLTNTWPRTIQNINIHANKS* |
| Ga0068863_1010599752 | 3300005841 | Switchgrass Rhizosphere | KMAAPGTGTGAPQMDQRLLTNTWPKTIHNINIHANNSIY* |
| Ga0068863_1015541681 | 3300005841 | Switchgrass Rhizosphere | AAAQTDPKTAAPGTGTGAPQMDQRLLTNTWPKQCTEISIQANTNKN* |
| Ga0068863_1019616501 | 3300005841 | Switchgrass Rhizosphere | AAPGTGTGAPQMDQRLLTNTWPKTIHNINIHANNRKN* |
| Ga0068863_1019741691 | 3300005841 | Switchgrass Rhizosphere | PKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANSNKN* |
| Ga0068863_1022073771 | 3300005841 | Switchgrass Rhizosphere | PRTAPAAAQTDPKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQANINKN* |
| Ga0068863_1023103582 | 3300005841 | Switchgrass Rhizosphere | AQTAPKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQANTNKN* |
| Ga0068863_1024741501 | 3300005841 | Switchgrass Rhizosphere | AAAQTGQKTAAPGTGTGAPPVAQRLLTTHGQKQGNNINIHANKG* |
| Ga0068863_1025775911 | 3300005841 | Switchgrass Rhizosphere | MATLGTGTGAPQMDHRLLTNTWPKAKHTISIQANT |
| Ga0068863_1026364822 | 3300005841 | Switchgrass Rhizosphere | AAQTGRKTAAPGTGTGAPQMDHRLLTNTRPKAKHTISIQANTNKS* |
| Ga0068863_1026971521 | 3300005841 | Switchgrass Rhizosphere | KTAAPGTGTGAPQLDQRLLTNTWPKTIHNNKHASKH* |
| Ga0068860_1016137831 | 3300005843 | Switchgrass Rhizosphere | TAQAAAQTAPKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQANTNKN* |
| Ga0068860_1017336102 | 3300005843 | Switchgrass Rhizosphere | GTGTEAPQMDRRLLTNTWPKTIHNINIHANNSKS* |
| Ga0068860_1023655143 | 3300005843 | Switchgrass Rhizosphere | CLPRTALAAAQTAPKTAAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKN* |
| Ga0068860_1026566601 | 3300005843 | Switchgrass Rhizosphere | PKTAAPGTGTGAPQMDQRLLTNTWPKQCTEISIQANTSKN* |
| Ga0105247_106950051 | 3300009101 | Switchgrass Rhizosphere | QTGRKTAAPGTGTGARQMDQRLLTNTWPKQGTTISIQANTNKS* |
| Ga0105127_121351 | 3300009971 | Switchgrass Associated | PRTALAAAQTDPKTAALGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN* |
| Ga0105137_1052501 | 3300009972 | Switchgrass Associated | KMAAPGTGTGATQMDQRLLTNTWPKTIHNINIHANNSKN* |
| Ga0105136_1123802 | 3300009973 | Switchgrass Associated | PAAAQTGRKTVAPGTGTGAPPVAQCLLTNTWPKTIHNINIHANNRKN* |
| Ga0105129_1124531 | 3300009975 | Switchgrass Associated | PRTAPAAAQSARKTAAPGTGTGALPVTQRLLTNTWPKQGTTISIQANTNKN* |
| Ga0105128_1087971 | 3300009976 | Switchgrass Associated | CLPRTALAAAQTAPKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN* |
| Ga0105128_1113701 | 3300009976 | Switchgrass Associated | CYTCLPQTAPAATQTAQKMAAPGTDTGAPQMDQRLLTNTWPKARHTISIQENTNKS* |
| Ga0105135_1055971 | 3300009980 | Switchgrass Associated | FLPQTAPAAAQTAQKMAAPGTGTGAAQMDQRLLTNTWPKTIHNINIHANKGKH* |
| Ga0105135_1217331 | 3300009980 | Switchgrass Associated | PGTGTGAPQMDQRLLTNTWPKTIHNINIHANNSKN* |
| Ga0105135_1232761 | 3300009980 | Switchgrass Associated | GTGTGAPPVAQRLLMNTWPKQGTTISIQANTNKS* |
| Ga0105135_1272661 | 3300009980 | Switchgrass Associated | AQTGRKMAPGTGTGAPQLDQRLLTNTWPKTIHNINIQENTNKS* |
| Ga0105133_1129101 | 3300009981 | Switchgrass Associated | RTALVAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKS* |
| Ga0105131_1182621 | 3300009989 | Switchgrass Associated | PRTALAAAQTDPKTAAPGTGTEALQMDQRLLTNTWPKQCTGISIQANTNKN* |
| Ga0105131_1216041 | 3300009989 | Switchgrass Associated | PRTALAAAQTAPKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQANTNKN* |
| Ga0105131_1244701 | 3300009989 | Switchgrass Associated | ARKTAAPGTGTGAPQMDQRLLTNTWPKQCTIINIQANTNKS* |
| Ga0105132_1233011 | 3300009990 | Switchgrass Associated | PAAAQTGQKTAAPGIGNGAPPVAQRLLTNTWPKTMHNINIQANTNKR* |
| Ga0105132_1268951 | 3300009990 | Switchgrass Associated | PKAAAPGTDTEAPQLDQRLLTNTWPKQCTNISIQANTNKN* |
| Ga0105132_1329711 | 3300009990 | Switchgrass Associated | PRTASAAAQTGQNMAAPGTGTGAPQMDQRLLTNTWPKQSTTISIQANTNKN* |
| Ga0105120_10268741 | 3300009992 | Switchgrass Associated | VDAAPGTGTGDPPVDQRLLMNTWPKQYTTISIQANTNKN* |
| Ga0105126_10422451 | 3300009994 | Switchgrass Associated | PRTALAAAQTDPKTAAPGTGTGAPQMDQRLLTNTWPKQCTGISIQANTNKN* |
| Ga0105126_10468461 | 3300009994 | Switchgrass Associated | ALAAAQTGQKTAAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKS* |
| Ga0105139_10394741 | 3300009995 | Switchgrass Associated | AQTAQKMVAAPGNGTGAPPVAQYLLTNTWTKTMHNINIHANKG* |
| Ga0105139_10470812 | 3300009995 | Switchgrass Associated | CYTCLPRTAPAAVESARKTAAPVTGTGATQMDQRLLTNTWLKTIHNINIHADNSKN* |
| Ga0105139_10932461 | 3300009995 | Switchgrass Associated | MAAPGTGIGATDQMDQRLLTNTWPKTIHNINIHANNSKN |
| Ga0105139_11184441 | 3300009995 | Switchgrass Associated | PRTALAAAQSARKTAAPGTGTEAPQMDQRLLTNTWPKQCTKISIQTNINKN* |
| Ga0134105_10693772 | 3300010263 | Switchgrass Degrading | AQTGQKTAAPGIGTGAPPVAQRLLTNTWPKTMHNINIQANTNKN* |
| Ga0134125_115828871 | 3300010371 | Terrestrial Soil | AAAQSAPKTAAPGTGTEAPQMDQRLLTNTWPKQCTKISIQANINKN* |
| Ga0134126_111726431 | 3300010396 | Terrestrial Soil | QTVPAAAQSDMKTAALGTSTGAPQMDQRLLANTWPKTIHNINIHANNSKY* |
| Ga0134126_114825111 | 3300010396 | Terrestrial Soil | LKLLRKMAAPGTGTAATDQMDQRLLTNTWPKIIHNINIHANNIKN* |
| Ga0134124_109717071 | 3300010397 | Terrestrial Soil | RTAPVAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQRTTISIQANTNKN* |
| Ga0134124_118464432 | 3300010397 | Terrestrial Soil | ALGTGTGALQMDQHLLTNTWPKTIHNINIHANNRKN* |
| Ga0134127_118428391 | 3300010399 | Terrestrial Soil | TAPAAAQTELKTDAAPGTDTGSPQMDQRLLTITWPKTVHNINIQANKG* |
| Ga0134127_118503901 | 3300010399 | Terrestrial Soil | PGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKN* |
| Ga0134122_111681671 | 3300010400 | Terrestrial Soil | AAAQTDPKTAAPGTGTGAPQKDQRLLTNTWPKQCTKISIQATLTKS* |
| Ga0134122_128954591 | 3300010400 | Terrestrial Soil | TCLPRTAAAAAQSGQKTDALGTGTGAPPVTQLLLTNTWPKQGTTISIQANNNKS* |
| Ga0134121_110408831 | 3300010401 | Terrestrial Soil | RKMAAPGTGTGAPQMDQRLLTNTWPKQHAKISIQANTNKN* |
| Ga0134123_134971051 | 3300010403 | Terrestrial Soil | QTALKMALGTGTEAPQMGQRLLTNTWPKTTHNINIQANTNKN* |
| Ga0163163_123328331 | 3300014325 | Switchgrass Rhizosphere | VPQTAPAAAQIDLKMAALGTGTGAPHMDQRLLTNTWPKAIHNINIHANKG* |
| Ga0157379_123170921 | 3300014968 | Switchgrass Rhizosphere | TQTAPKMAAPGTGTGAPQMDQRLLTNTWPKQCTTMSIQANTNKN* |
| Ga0182183_10638961 | 3300015270 | Switchgrass Phyllosphere | KTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANSNKS* |
| Ga0182102_10033802 | 3300015273 | Switchgrass Phyllosphere | TAPVAAQTSLKMALGTGTGAPQMDPRLLTNTWPKTIHNINIHANNSKS* |
| Ga0182102_10117501 | 3300015273 | Switchgrass Phyllosphere | GTGTGAPQMDQRLLTNTWPKRGTTISIQANTNKN* |
| Ga0182102_10249261 | 3300015273 | Switchgrass Phyllosphere | TAPAAAQTGRKMAAPGTGTGTGAPQMDQRLLTNTWPKTIHNINIHANNIKN* |
| Ga0182099_10276611 | 3300015278 | Switchgrass Phyllosphere | AAPGTGTGAPQMDQRLLTNTWPKQRTTISIQANTSKN* |
| Ga0182100_10287261 | 3300015280 | Switchgrass Phyllosphere | RKTAAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKS* |
| Ga0182101_10924951 | 3300015284 | Switchgrass Phyllosphere | KTAAPGTGTGTGAPQMDQRLLTNTWPKQGPTISIQANTNKN* |
| Ga0182104_10585051 | 3300015297 | Switchgrass Phyllosphere | KTAAPGTGTGAPQMDQRLLTNTWPKTIQNINIHANKS* |
| Ga0182184_10878171 | 3300015301 | Switchgrass Phyllosphere | PRTAPAAAQTGQKTAAPGTGTGAPPVAQRLLTNTWPKTMHNSKHTCEH* |
| Ga0182180_10387381 | 3300015306 | Switchgrass Phyllosphere | LPRTAPAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN* |
| Ga0182098_10345361 | 3300015309 | Switchgrass Phyllosphere | TCLPRTAPAAAQTGQKTAAPGTGTRASPVAQRLLTNTWPKIIQNINIHANKS* |
| Ga0182098_11204032 | 3300015309 | Switchgrass Phyllosphere | GTGTGAPQMDQRLLTNTWPKQRTTISIQANTSKN* |
| Ga0182162_10592921 | 3300015310 | Switchgrass Phyllosphere | TAPAATQTGRKTAALGTGTGAPQMDHRLLTNTWPKQGTTISLQAITNKS* |
| Ga0182162_11143401 | 3300015310 | Switchgrass Phyllosphere | PQTAPAAAVTDLKMDAPGTGTEAPQVAQRLLTNTWLKTIHNINIHANNSIH* |
| Ga0182182_11028071 | 3300015311 | Switchgrass Phyllosphere | ALAAAQSARKMAAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKS* |
| Ga0182168_11024101 | 3300015312 | Switchgrass Phyllosphere | RTALAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQCTKIGIQANTNKN* |
| Ga0182164_11171711 | 3300015313 | Switchgrass Phyllosphere | PAAAQSARKTAVPGTGTGAPPVAQRLLTNTWPKTIHNINIRANTNKS* |
| Ga0182120_10748871 | 3300015315 | Switchgrass Phyllosphere | TGQKTAAPGTGTGAPPVAQRLLTNTWPRPIQNLNIHANKS* |
| Ga0182120_10864131 | 3300015315 | Switchgrass Phyllosphere | PGTGTGAPQVAQRLLTNTWPKTIHNINIHANNNIY* |
| Ga0182181_11001841 | 3300015318 | Switchgrass Phyllosphere | RTAPTAAQTDLKTDAPGTGTEAPQIAQRLLPNTWPKTIHNINIHANKRKS* |
| Ga0182130_10687901 | 3300015319 | Switchgrass Phyllosphere | AQTTQKVVAALSTGTRAPPTDQRLLTNTWPKTIHNINIHANNC* |
| Ga0182130_10743741 | 3300015319 | Switchgrass Phyllosphere | RKTAAPGTGTGAPQMDQRLLTNTWPKQSTTISIHANKC* |
| Ga0182130_10800511 | 3300015319 | Switchgrass Phyllosphere | AAQSAPKTAAPGTGTEAPQMGQRLLTNTWPKQCTKISIQANIDKN* |
| Ga0182134_10354961 | 3300015324 | Switchgrass Phyllosphere | PAAAQTGQKTAAPGTGTGAPQMDQRLLTNTWPKQGTTVSIQANTNKS* |
| Ga0182148_10633441 | 3300015325 | Switchgrass Phyllosphere | LKMAAPGTGTGAPQMDQHLLTNTWPKTIHNINIHAKNSKN* |
| Ga0182166_11073911 | 3300015326 | Switchgrass Phyllosphere | KMAAPGTGTGAPQMDQRLLTNTWPKTIHNINIHANNSKN* |
| Ga0182166_11405871 | 3300015326 | Switchgrass Phyllosphere | YTCLPQTAPAAQTAQKMAAPGTGTGATDQMDQRLLTNTWPKTIHNINIHANNSKN* |
| Ga0182114_10820951 | 3300015327 | Switchgrass Phyllosphere | ARKTAAPGTGTGAPPVAQRLLTNTWPKQSITLSIHANKC* |
| Ga0182114_11194321 | 3300015327 | Switchgrass Phyllosphere | MLYLPSRTTPAAAQTGRKTATPGTGTGAPQMDQRLLTNTWPKQGTTI |
| Ga0182114_11604201 | 3300015327 | Switchgrass Phyllosphere | KMAAPSTGTGTPPVAQRLLTNTWPKTIHNINIHANKG* |
| Ga0182153_11148281 | 3300015328 | Switchgrass Phyllosphere | LPRTAPAAAQSAQKTTAPGTGTRAPPVAQCLLPNTWQKTMHNINIQANTNKN* |
| Ga0182135_10486051 | 3300015329 | Switchgrass Phyllosphere | QKMAAPGTGTGAHQVDQRLLTNTWPKIIHNINIHANNSIY* |
| Ga0182152_10527131 | 3300015330 | Switchgrass Phyllosphere | SSLAAQAALKMAPGTGTDAPRMDQCLLTNTWPKQGTTISIQANTNKS* |
| Ga0182152_10644491 | 3300015330 | Switchgrass Phyllosphere | QKTAAPGTGTGAPQMAQRLLTNTWPKQGTTVNIHAKNSKN* |
| Ga0182152_11008871 | 3300015330 | Switchgrass Phyllosphere | KTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN* |
| Ga0182152_11035651 | 3300015330 | Switchgrass Phyllosphere | RKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQADSNKS* |
| Ga0182152_11190511 | 3300015330 | Switchgrass Phyllosphere | KMAAPGTGTGAPQMDQRLLTNTWPKTIHNINIHANKS* |
| Ga0182152_11519821 | 3300015330 | Switchgrass Phyllosphere | PGIGTGAPQMDQRLLTNTWLKQGTTISIQENTNKN* |
| Ga0182131_10102671 | 3300015331 | Switchgrass Phyllosphere | APAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKTIQNINIRANKS* |
| Ga0182131_11227621 | 3300015331 | Switchgrass Phyllosphere | MAAPGTGTGAPQMDQHLLTNTWPKTIHNINIHANNSK |
| Ga0182117_10472911 | 3300015332 | Switchgrass Phyllosphere | AAAQTAPKMAAPGTGTGAPQKDQRLLTNTWPKQCTTISIQANTNKN* |
| Ga0182117_10562961 | 3300015332 | Switchgrass Phyllosphere | AAQTGRKTAAPGTGTGAPQMDHHLLTNTRPKAKHTISIQANTNKS* |
| Ga0182117_10616882 | 3300015332 | Switchgrass Phyllosphere | PQTVPAAAQIDLKMAAPGTGTGAPKMDQRLLTNTWPKTIHNLNIQANSNKKAKK* |
| Ga0182147_10573321 | 3300015333 | Switchgrass Phyllosphere | GTGTGATQMDQRLLTNTWPKTIHNINIDTNNSKN* |
| Ga0182147_11131801 | 3300015333 | Switchgrass Phyllosphere | CLPRTAPATAQTDQKTAAPGTSTGAPQMDQHLLTNTWPKQGTTISIQANTNKN* |
| Ga0182147_11465351 | 3300015333 | Switchgrass Phyllosphere | RTAPATTQTGQKTAAPGTGTGALQMDQRLLTNTWPKTIHNINIQANKSKH* |
| Ga0182132_10545681 | 3300015334 | Switchgrass Phyllosphere | QTALKMDLGTGTEAPQMDQRLLTNTWPKTIQNINIRANKS* |
| Ga0182116_11043221 | 3300015335 | Switchgrass Phyllosphere | LKMNAAPGTGTGAPQMDQRLLTNTWPKARHTISIQANTNKS* |
| Ga0182116_11333831 | 3300015335 | Switchgrass Phyllosphere | AQAAAQTAPKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIKANTNKN* |
| Ga0182116_11537221 | 3300015335 | Switchgrass Phyllosphere | TCLPQTAPAAAQTDLKMDAAPGTGTGAPPVAQRLLTNTWKKQGNNINIQANKCKH* |
| Ga0182116_11592931 | 3300015335 | Switchgrass Phyllosphere | TCLPQTAPAAVTDLKMDALGTGTEAPQVAQRILTNTWLKTIHIINIHANNNIH* |
| Ga0182151_11635012 | 3300015337 | Switchgrass Phyllosphere | AAPGTGTGAPQMDQRLLTNTWPKTRHNKNIHANNSKN* |
| Ga0182137_10518391 | 3300015338 | Switchgrass Phyllosphere | AAAQTGQKTAAPGTGTGAPQMDQRLLTNTWPKTIQNINIHANKS* |
| Ga0182137_11127261 | 3300015338 | Switchgrass Phyllosphere | KTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKS* |
| Ga0182137_11617901 | 3300015338 | Switchgrass Phyllosphere | PGTGTGAPPVAQRLLTNTWPKTIHNINIHANNSIH* |
| Ga0182137_11670901 | 3300015338 | Switchgrass Phyllosphere | RTAPAAAQTGQKTAAPGTGTGAPPVAYRLLTNTWPKTSPAQYIQANTNKN* |
| Ga0182149_10661441 | 3300015339 | Switchgrass Phyllosphere | QTAQKMAALGTGTRAPQMDQRLLTNTWPKIRHNINIHANKC* |
| Ga0182149_11367741 | 3300015339 | Switchgrass Phyllosphere | KTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQAITNKN* |
| Ga0182133_10533111 | 3300015340 | Switchgrass Phyllosphere | AAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTSKN* |
| Ga0182133_11355461 | 3300015340 | Switchgrass Phyllosphere | KTAAPGTGTGAPQMDQRLLTNTWPKQCTVISIQANTNKN* |
| Ga0182115_12037821 | 3300015348 | Switchgrass Phyllosphere | CLPRTAPAATQTGRKTAAPGTGTGAPPVAQRLLTNTWPKQGNNINIHANKG* |
| Ga0182115_12142061 | 3300015348 | Switchgrass Phyllosphere | TALAAQTAQKMAAPGTGTGATQMDQRLLTNTWPKIIHNINIHANNSKN* |
| Ga0182115_12250051 | 3300015348 | Switchgrass Phyllosphere | TAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN* |
| Ga0182115_12272861 | 3300015348 | Switchgrass Phyllosphere | QKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN* |
| Ga0182185_11423341 | 3300015349 | Switchgrass Phyllosphere | TAPAAAQTDLKMDAPGTGTGVPPVAQRLLTNTWPKQCTTISIQANTSKN* |
| Ga0182185_11996851 | 3300015349 | Switchgrass Phyllosphere | VILAFLKSYPAAQTVLKMAPGTGTGAPQMDQCLLTNTWPKQCTIISIQANTNKN* |
| Ga0182185_12742461 | 3300015349 | Switchgrass Phyllosphere | AQTDLKMDAAPGTGTGAPQMDQRLLTNTLPKIIHNINIHANNSKN* |
| Ga0182185_12807352 | 3300015349 | Switchgrass Phyllosphere | AAAQTGRKTAAPGTGTGAPPVAQRLLTNTWPKTMHNINIQANTNKS* |
| Ga0182163_12368202 | 3300015350 | Switchgrass Phyllosphere | LPQTSPAAAQTAQKMVAAPDTGTRAPQMDQRLLTNTWPKTIHNINIHANNSKN* |
| Ga0182169_10679181 | 3300015352 | Switchgrass Phyllosphere | PQIVPAAAQTDLKINAAPGTGTGAPQMDQRLLSNTWPKQCTTISIQVNTNKS* |
| Ga0182169_11452311 | 3300015352 | Switchgrass Phyllosphere | PHTAPATAQTAQKTAAPGTGTGAPPVAQCLLTNTWPKIKHNINIQANTNKS* |
| Ga0182169_11899541 | 3300015352 | Switchgrass Phyllosphere | TCLPRTAPAAAQTGQKTAAPGTGTGAPQMDQRLFTNTWPKTIHNINIQANTNKS* |
| Ga0182179_12649441 | 3300015353 | Switchgrass Phyllosphere | ALGTGTGAPQMDQRLLTNTWPKTIHNINIHTNKG* |
| Ga0182179_13226431 | 3300015353 | Switchgrass Phyllosphere | PKMAPGTGTEAPQMDQRLLTNTWPKTIHHINIHANKSKL* |
| Ga0182167_13011952 | 3300015354 | Switchgrass Phyllosphere | LPQTTPAAAQTDLKMDAPGTGTEATQMDQRLLTNTWPKTMHNINIHANNNKN* |
| Ga0182167_13144701 | 3300015354 | Switchgrass Phyllosphere | PRTALATAQTAPKTAAPGTGTGAPQMDQRLLTNTRPKQCTIISIQANTNKN* |
| Ga0182167_13226831 | 3300015354 | Switchgrass Phyllosphere | TALATAQTGQNTAAPGTGTGAPQMDQRLLTNTWPKTIHNINIQANKSKH* |
| Ga0182195_12038981 | 3300017414 | Switchgrass Phyllosphere | RTAPTAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQRTTISIQVNTSKN |
| Ga0182201_10549392 | 3300017422 | Switchgrass Phyllosphere | PRTAPAAAQSAQKTTALGTGTRAPPVAQCLLPNTWQKTMHNINIQANTNKS |
| Ga0182201_10863941 | 3300017422 | Switchgrass Phyllosphere | PKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANSNKN |
| Ga0182201_11360441 | 3300017422 | Switchgrass Phyllosphere | PGTGTGAPQMDQRLLTNTWPKTIHNINIHANNSKN |
| Ga0182194_10751421 | 3300017435 | Switchgrass Phyllosphere | TAPAAAQTGRKMAAPGTGTGAPQLDQRLLTNTWPKARHTISIQANTNKC |
| Ga0182194_10787581 | 3300017435 | Switchgrass Phyllosphere | PRTAPATQTAQKMAAPGTGTGASQMDQRLLTNTWPKQGTTISIQAITNKS |
| Ga0182194_10792881 | 3300017435 | Switchgrass Phyllosphere | AAPGTGTGAPQMDQRLLTNTWPKQSMIISRQANSNKS |
| Ga0182200_10843171 | 3300017439 | Switchgrass Phyllosphere | SCYTCLPRTAPATAQSARKTAAPGTGTGAPQMDQRLLTNTWPKTIHNINIHANNSIY |
| Ga0182214_11182131 | 3300017440 | Switchgrass Phyllosphere | MLYFLPRTALAAAQSGQKTAAPGIGTGAPQMDQRLLTNTWPKQCTIISILANTNKS |
| Ga0182214_11503911 | 3300017440 | Switchgrass Phyllosphere | PTAQTTMKIVAAPGTGTGAPQMDQRLLTNTWPKTIHNINIQADKG |
| Ga0182198_11601781 | 3300017445 | Switchgrass Phyllosphere | QTGLKTATPGTGTGAPQMDQRLLTNTWPKQGTTANTHANNNIY |
| Ga0182210_10925841 | 3300017692 | Switchgrass Phyllosphere | CLPQTIPAAQTVPKMAPGTGTEAPQMDRRLLTNTWPKTIHHINIHANKSKL |
| Ga0182210_11270311 | 3300017692 | Switchgrass Phyllosphere | CLPQTAPTAQTAQKMDAPGTGTGAPLVAQRLLTNTWPKTIHNINIHANNSIY |
| Ga0182216_10713241 | 3300017693 | Switchgrass Phyllosphere | RTAPAAAQTGRKTAAPGTGTGAPQMDQRLLTNTWTKTIHNISIQANANKS |
| Ga0182216_11160461 | 3300017693 | Switchgrass Phyllosphere | TDLKMDAAPGTGTGAPQMDQRLLTNTWPKTRHNINIHANNSKN |
| Ga0182216_11383252 | 3300017693 | Switchgrass Phyllosphere | KTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN |
| Ga0182216_12072621 | 3300017693 | Switchgrass Phyllosphere | CLPQTAPAAAVTDLKMDALGTGTEAPQVAQRILTNTWLKTIHNINIHANNNIH |
| Ga0182146_1052131 | 3300020033 | Switchgrass Phyllosphere | QTAPAAAQTDLKMAAPGTGTGAPQMDQHLLTNTWPKIIHNINIHANNSIY |
| Ga0182146_1054611 | 3300020033 | Switchgrass Phyllosphere | PGTGTGAPPVTQRLLTNTWPKTRHNINIQENTNKN |
| Ga0207668_115209072 | 3300025972 | Switchgrass Rhizosphere | TGQKTAAPGTGTGAPPVAQRLLTNTWPKTMHNINIQANTNKN |
| Ga0207641_114570751 | 3300026088 | Switchgrass Rhizosphere | PRTAPATAQTGQKTAAPGTGTGASPVAQRLLTNTWPRTIQNINIHANKS |
| Ga0207641_121086031 | 3300026088 | Switchgrass Rhizosphere | PRTTPAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQTNINKN |
| Ga0268322_10552171 | 3300028049 | Phyllosphere | RTAPAAAQTSRKTAAPGTGTGAPPVAQRLLTNTWPKTRHNINIHANKC |
| Ga0268328_10143601 | 3300028050 | Phyllosphere | AAAQTGWKTATPGTGTGAPQMDHHLLTNTWPKARHTISIQENTNKS |
| Ga0268328_10434081 | 3300028050 | Phyllosphere | AAVTDLKMDAPGTGTEAPQVAQRLLTNTWLKTIHNINLQANNSIH |
| Ga0268328_10448262 | 3300028050 | Phyllosphere | TTPIAAQTGRKTAAPGTGTGAPQMDHRLLTNTRPKAKHTISIQANTNKS |
| Ga0268346_10200892 | 3300028053 | Phyllosphere | LAFLKSSPAAQTALKMALGTGTDAPPVAQRLLTNTWPKQCTIISIQANTNKN |
| Ga0268346_10304562 | 3300028053 | Phyllosphere | LPRTALAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQCTVISIQANTNKN |
| Ga0268306_10170341 | 3300028054 | Phyllosphere | TALAAAQTGQKTAAPGTGTGAPPVAQRLLTNTWPKTMHNINIQANTNKN |
| Ga0268332_10299861 | 3300028058 | Phyllosphere | PRTTPATTKSGRKMAAPGTGTGAPQMDQHLLTNTWPKQGTTISIQANTNKS |
| Ga0268332_10406811 | 3300028058 | Phyllosphere | AQSGQKTAAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKN |
| Ga0268332_10430471 | 3300028058 | Phyllosphere | IPATAQTDLKMDAAPGTGTGAPQMDQRLLTNTLPKIIHNINIHANNSKN |
| Ga0268332_10432841 | 3300028058 | Phyllosphere | QNARKTAAPGTGTDAPPVAQRLLTNTWPKQGTTISIHANKC |
| Ga0268332_10566061 | 3300028058 | Phyllosphere | CLPRTTPTAAQTGRKTAAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKS |
| Ga0268314_10229151 | 3300028061 | Phyllosphere | RTAPATAQSDRMTAAPGTDTGAPQMDQRLLTNTWPKARHTISIQANTNKS |
| Ga0268342_10326351 | 3300028062 | Phyllosphere | QTAQKMAAPGTGTGATDQMDQRLLTNTWPKTIHNINIHANNRKTKKQ |
| Ga0268340_10452331 | 3300028064 | Phyllosphere | PQTAPATAQTDLKMAAPGTGTGAPQMDQHLLTNTWPKIIHNINIHANNSIY |
| Ga0268340_10512511 | 3300028064 | Phyllosphere | MDAALGTGTGAPQMDQRLLTNTWPKTRHNINIHANNSKN |
| Ga0268334_10103591 | 3300028140 | Phyllosphere | TAAPGTGTEAPRMDQRLLTNTWPKQCTKISIQANIDKN |
| Ga0268334_10108151 | 3300028140 | Phyllosphere | KTAAPGTGTGAPQVAQRLLTNTWPKQCTIISIPANTNKN |
| Ga0268347_10300691 | 3300028142 | Phyllosphere | LKMDAAPGTGTGAPQMDQRLLTNTLPKIIHNINIHANNSKN |
| Ga0268353_1092501 | 3300028149 | Phyllosphere | KTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANNNKN |
| Ga0268308_10035581 | 3300028151 | Phyllosphere | RKTAALGTGTGAPQMDHHLLTNTWPKARHTISIQANTNKS |
| Ga0268308_10171921 | 3300028151 | Phyllosphere | LGTGTGAPKMDQRLLTNTWPKTRHNINIHANNSKN |
| Ga0268336_10054191 | 3300028152 | Phyllosphere | MAAPGTGTGAPQMDQRLLTNTWPKIIHNINIHANNSIY |
| Ga0268341_10189541 | 3300028154 | Phyllosphere | TAAPGTGTGAPQMDQRLLTNTWPKTRHNINMQANTNKN |
| Ga0268341_10277051 | 3300028154 | Phyllosphere | YTCLPRTAPAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQANSNKN |
| Ga0268351_10269751 | 3300028246 | Phyllosphere | RTALAAAQSDPKTAAPGTGTGAPQMDQRLLTNTWPKQCTEISIQANTSKN |
| Ga0268316_10161761 | 3300028253 | Phyllosphere | AAQSARKTAAPGTGTEAPRMDQRLLTNTWPKQCTKISIQANIDKN |
| Ga0268310_10523911 | 3300028262 | Phyllosphere | AAQTDLKMDAAPSTGTGAPKMDQHLLTNTWPKTRHNINIHANNSKN |
| Ga0268302_1087071 | 3300028464 | Phyllosphere | CLPQTAPAAQSAQKVVAAPGTGTRAPPVAQRLLTNTWPKTIHNINIHANNSIH |
| Ga0268301_1030531 | 3300028465 | Phyllosphere | PAAAQSAPKTAAPGTGTGAPQMDQRLLTNTWPKQGTTISIQANTNKN |
| Ga0268307_10226511 | 3300028470 | Phyllosphere | RTAPAAAQSAQKMAAPGTGTGAPQMDQRLLTNTWTKQCTTISIQANTNKN |
| Ga0268319_10171001 | 3300028473 | Phyllosphere | KTAAPGTGTGAPPVTQRLLTNTWPKQGTTISIQANTNKN |
| Ga0268313_10046021 | 3300028523 | Phyllosphere | LPRTALAAAQTARKTAAAPSTGTGAPQKDQRLLTNTWPKQCTIISIQANTSKN |
| Ga0268339_10020731 | 3300028526 | Phyllosphere | AAQSAQKVVAAPGTGTGAPQMDQRLLTNTWPKTIHNINIHANKS |
| Ga0214493_11353082 | 3300032465 | Switchgrass Phyllosphere | YTCLPQTAPAAAQTDLKMATAGTGTGAPQMDQRLLTNTWPKTIHNINIHANNSKN |
| Ga0214490_11393602 | 3300032502 | Switchgrass Phyllosphere | KTAAPGTGTGAPQMDQRLLTNTWPKQCTEISIQANTNKN |
| Ga0214501_12326941 | 3300032625 | Switchgrass Phyllosphere | PAAAQSARKTAAPGTGTGAPQMDQRLLTNTWPKQCTKISIQANTNKN |
| Ga0214497_11002001 | 3300032689 | Switchgrass Phyllosphere | LASLKSSSAAQTALKMASGTSTDAPQMDQRLLTNTWPKQCTIISIQANSNKN |
| Ga0214497_11250271 | 3300032689 | Switchgrass Phyllosphere | PQMDQRLPRTAPAAAQTDLKTDAAPGTDTGSPQMDQRLLTITWPKTVHNINIQANKG |
| Ga0214485_11088961 | 3300032698 | Switchgrass Phyllosphere | LPRTAPAATQSARKTAAPGTGTGTGAPRLDQRLLTNTWPKQCTKISIQANINKN |
| Ga0314736_10131821 | 3300032843 | Switchgrass Phyllosphere | ALAAAQTGRKTAAPGTGTGAPQMDQRLLTITWPKTRHNINIHANNSKN |
| Ga0314767_11772891 | 3300033532 | Switchgrass Phyllosphere | KTRLRFLNLPRTAPAAAQTSRKTAAPGTGTGAPPVAQRLVTNTWPKTIHNINIHANNSKN |
| Ga0314755_11468172 | 3300033538 | Switchgrass Phyllosphere | YTCLPQIVPAAAQTDLKINAAPGTGTGAPQMDQRLLSNTWPKQCTTISIQVNTNKS |
| ⦗Top⦘ |