3300001225: Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 11_joined

Overview

Basic Information

• IMG/M Taxon OID: 3300001225
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0087863 | Gp0055701 | Ga0012560
• Sample Name: Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 11_joined
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Tennessee
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 5351985
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: East Tennessee Research and Education Center, Knoxville, Tennessee, USA
• Coordinates
  • Lat. (^o): 35.9606
  • Long. (^o): -83.9208
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020839	Metagenome / Metatranscriptome	221	Y
F061048	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
SwM_106623	Not Available	582
SwM_113819	All Organisms → cellular organisms → Bacteria → Proteobacteria	510

Sequences

Scaffold ID	Protein ID	Family	Sequence
SwM_106623	SwM_1066231	F020839	PRTAPAAAQSAQKTAAPGTGTGAPQMDQRLLTNTWPKQCTIISIQANTNKN*
SwM_113819	SwM_1138192	F061048	MSLDLVALKDEPSTTRNARPRRSLDLETESVVRVLPIRWRLFS