| Basic Information | |
|---|---|
| Family ID | F020786 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 222 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MVGMALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 222 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.04 % |
| % of genes near scaffold ends (potentially truncated) | 15.77 % |
| % of genes from short scaffolds (< 2000 bps) | 76.58 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.784 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.622 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.225 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.892 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 222 Family Scaffolds |
|---|---|---|
| PF09723 | Zn-ribbon_8 | 44.14 |
| PF03816 | LytR_cpsA_psr | 8.56 |
| PF00587 | tRNA-synt_2b | 4.50 |
| PF00590 | TP_methylase | 3.15 |
| PF00480 | ROK | 2.25 |
| PF03129 | HGTP_anticodon | 1.80 |
| PF12680 | SnoaL_2 | 1.80 |
| PF03176 | MMPL | 1.35 |
| PF04989 | CmcI | 1.35 |
| PF00884 | Sulfatase | 1.35 |
| PF09334 | tRNA-synt_1g | 0.90 |
| PF00561 | Abhydrolase_1 | 0.90 |
| PF14248 | DUF4345 | 0.90 |
| PF04185 | Phosphoesterase | 0.45 |
| PF00474 | SSF | 0.45 |
| PF13231 | PMT_2 | 0.45 |
| PF12697 | Abhydrolase_6 | 0.45 |
| PF13683 | rve_3 | 0.45 |
| PF01551 | Peptidase_M23 | 0.45 |
| PF13460 | NAD_binding_10 | 0.45 |
| PF01061 | ABC2_membrane | 0.45 |
| PF03354 | TerL_ATPase | 0.45 |
| PF00144 | Beta-lactamase | 0.45 |
| PF00150 | Cellulase | 0.45 |
| PF00589 | Phage_integrase | 0.45 |
| PF00486 | Trans_reg_C | 0.45 |
| PF10057 | MpsC | 0.45 |
| PF02910 | Succ_DH_flav_C | 0.45 |
| PF07452 | CHRD | 0.45 |
| PF00196 | GerE | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 222 Family Scaffolds |
|---|---|---|---|
| COG1316 | Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase) | Cell wall/membrane/envelope biogenesis [M] | 8.56 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 4.50 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG3510 | Cephalosporin hydroxylase | Defense mechanisms [V] | 1.35 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.35 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.35 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.45 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.45 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.45 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.45 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.78 % |
| Unclassified | root | N/A | 16.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725001|GPWNP_F5MPXY301BXKV4 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 516 | Open in IMG/M |
| 3300000532|CNAas_1007333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 716 | Open in IMG/M |
| 3300000549|LJQas_1000721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5261 | Open in IMG/M |
| 3300000858|JGI10213J12805_11241022 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300000956|JGI10216J12902_109486196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2137 | Open in IMG/M |
| 3300000956|JGI10216J12902_111804860 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300001686|C688J18823_10270980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1122 | Open in IMG/M |
| 3300004013|Ga0055465_10020194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1517 | Open in IMG/M |
| 3300004114|Ga0062593_101769716 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005184|Ga0066671_10739276 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005539|Ga0068853_102050523 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005562|Ga0058697_10005615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4022 | Open in IMG/M |
| 3300005562|Ga0058697_10799544 | Not Available | 510 | Open in IMG/M |
| 3300005578|Ga0068854_100162737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1730 | Open in IMG/M |
| 3300005719|Ga0068861_101443117 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005843|Ga0068860_102103653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 586 | Open in IMG/M |
| 3300005981|Ga0081538_10000935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 31514 | Open in IMG/M |
| 3300005981|Ga0081538_10006415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10360 | Open in IMG/M |
| 3300005981|Ga0081538_10017289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5481 | Open in IMG/M |
| 3300005981|Ga0081538_10030599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3650 | Open in IMG/M |
| 3300005981|Ga0081538_10033197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3441 | Open in IMG/M |
| 3300005981|Ga0081538_10041559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2916 | Open in IMG/M |
| 3300005981|Ga0081538_10089586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1596 | Open in IMG/M |
| 3300005981|Ga0081538_10213407 | Not Available | 775 | Open in IMG/M |
| 3300005981|Ga0081538_10291353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300005981|Ga0081538_10294815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300006038|Ga0075365_10011283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5249 | Open in IMG/M |
| 3300006038|Ga0075365_10352875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1037 | Open in IMG/M |
| 3300006038|Ga0075365_11192203 | Not Available | 536 | Open in IMG/M |
| 3300006046|Ga0066652_100065939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2797 | Open in IMG/M |
| 3300006058|Ga0075432_10012706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2860 | Open in IMG/M |
| 3300006058|Ga0075432_10271612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 695 | Open in IMG/M |
| 3300006169|Ga0082029_1166616 | All Organisms → cellular organisms → Bacteria | 4410 | Open in IMG/M |
| 3300006196|Ga0075422_10225308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
| 3300006844|Ga0075428_100235123 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300006844|Ga0075428_100284300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1780 | Open in IMG/M |
| 3300006844|Ga0075428_100467927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1350 | Open in IMG/M |
| 3300006844|Ga0075428_100921024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300006845|Ga0075421_100010719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 11333 | Open in IMG/M |
| 3300006845|Ga0075421_100339391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1818 | Open in IMG/M |
| 3300006845|Ga0075421_102437562 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006846|Ga0075430_100113636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2257 | Open in IMG/M |
| 3300006846|Ga0075430_100672632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 853 | Open in IMG/M |
| 3300006847|Ga0075431_100189163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2110 | Open in IMG/M |
| 3300006847|Ga0075431_101305093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 687 | Open in IMG/M |
| 3300006880|Ga0075429_101640766 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300006894|Ga0079215_10130309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1165 | Open in IMG/M |
| 3300006894|Ga0079215_10252227 | Not Available | 937 | Open in IMG/M |
| 3300006894|Ga0079215_10582344 | Not Available | 724 | Open in IMG/M |
| 3300006894|Ga0079215_10992768 | Not Available | 616 | Open in IMG/M |
| 3300006918|Ga0079216_11057028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300007790|Ga0105679_10418640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1249 | Open in IMG/M |
| 3300009094|Ga0111539_10514521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1394 | Open in IMG/M |
| 3300009098|Ga0105245_10003187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 14669 | Open in IMG/M |
| 3300009098|Ga0105245_11423926 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300009100|Ga0075418_10536807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1257 | Open in IMG/M |
| 3300009101|Ga0105247_10515922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 873 | Open in IMG/M |
| 3300009147|Ga0114129_13126205 | Not Available | 540 | Open in IMG/M |
| 3300009148|Ga0105243_10563870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1090 | Open in IMG/M |
| 3300009148|Ga0105243_10874849 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300009148|Ga0105243_13027522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 510 | Open in IMG/M |
| 3300009156|Ga0111538_11769515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 778 | Open in IMG/M |
| 3300009551|Ga0105238_10568498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1139 | Open in IMG/M |
| 3300009789|Ga0126307_10002771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11889 | Open in IMG/M |
| 3300009789|Ga0126307_10012005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 6341 | Open in IMG/M |
| 3300009789|Ga0126307_10013541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5995 | Open in IMG/M |
| 3300009789|Ga0126307_11129297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 634 | Open in IMG/M |
| 3300009789|Ga0126307_11134739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 632 | Open in IMG/M |
| 3300009789|Ga0126307_11369463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 573 | Open in IMG/M |
| 3300009789|Ga0126307_11698682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 513 | Open in IMG/M |
| 3300009840|Ga0126313_10020022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4437 | Open in IMG/M |
| 3300009840|Ga0126313_10040940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3227 | Open in IMG/M |
| 3300009840|Ga0126313_10056170 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
| 3300009840|Ga0126313_10312522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1231 | Open in IMG/M |
| 3300009840|Ga0126313_10457640 | Not Available | 1018 | Open in IMG/M |
| 3300009840|Ga0126313_11639347 | Not Available | 536 | Open in IMG/M |
| 3300010036|Ga0126305_10181538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1326 | Open in IMG/M |
| 3300010036|Ga0126305_11076233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 553 | Open in IMG/M |
| 3300010038|Ga0126315_10534865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 751 | Open in IMG/M |
| 3300010038|Ga0126315_10992345 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010039|Ga0126309_10059251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1860 | Open in IMG/M |
| 3300010039|Ga0126309_10100096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1491 | Open in IMG/M |
| 3300010039|Ga0126309_10350927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 868 | Open in IMG/M |
| 3300010039|Ga0126309_10526582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 732 | Open in IMG/M |
| 3300010039|Ga0126309_10529575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 730 | Open in IMG/M |
| 3300010039|Ga0126309_10842288 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010039|Ga0126309_10856654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 598 | Open in IMG/M |
| 3300010040|Ga0126308_10024257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3310 | Open in IMG/M |
| 3300010040|Ga0126308_10174419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1370 | Open in IMG/M |
| 3300010040|Ga0126308_10384444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 934 | Open in IMG/M |
| 3300010041|Ga0126312_10000026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 52802 | Open in IMG/M |
| 3300010041|Ga0126312_10000506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 23425 | Open in IMG/M |
| 3300010041|Ga0126312_10009054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6667 | Open in IMG/M |
| 3300010041|Ga0126312_11130956 | Not Available | 576 | Open in IMG/M |
| 3300010042|Ga0126314_10338562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1078 | Open in IMG/M |
| 3300010042|Ga0126314_10550160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 840 | Open in IMG/M |
| 3300010042|Ga0126314_11159909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 576 | Open in IMG/M |
| 3300010044|Ga0126310_10106020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1713 | Open in IMG/M |
| 3300010044|Ga0126310_10835684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 711 | Open in IMG/M |
| 3300010399|Ga0134127_12085322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 645 | Open in IMG/M |
| 3300010403|Ga0134123_12379779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 594 | Open in IMG/M |
| 3300011000|Ga0138513_100005596 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1417 | Open in IMG/M |
| 3300011000|Ga0138513_100011979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
| 3300012042|Ga0136627_1081668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae | 1120 | Open in IMG/M |
| 3300012045|Ga0136623_10150888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1007 | Open in IMG/M |
| 3300012091|Ga0136625_1049886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1515 | Open in IMG/M |
| 3300012185|Ga0136619_10109114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1060 | Open in IMG/M |
| 3300012186|Ga0136620_10005527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5964 | Open in IMG/M |
| 3300012187|Ga0136622_10328354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 641 | Open in IMG/M |
| 3300012204|Ga0137374_10097601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2783 | Open in IMG/M |
| 3300012529|Ga0136630_1068332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1323 | Open in IMG/M |
| 3300012895|Ga0157309_10307875 | Not Available | 537 | Open in IMG/M |
| 3300012907|Ga0157283_10105771 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300012915|Ga0157302_10503179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 524 | Open in IMG/M |
| 3300012939|Ga0162650_100072707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 587 | Open in IMG/M |
| 3300014311|Ga0075322_1137624 | Not Available | 593 | Open in IMG/M |
| 3300014314|Ga0075316_1133373 | Not Available | 616 | Open in IMG/M |
| 3300014326|Ga0157380_11897386 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300014487|Ga0182000_10425363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300014487|Ga0182000_10505100 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300014488|Ga0182001_10309295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 644 | Open in IMG/M |
| 3300014488|Ga0182001_10583458 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300015077|Ga0173483_10595300 | Not Available | 607 | Open in IMG/M |
| 3300015371|Ga0132258_10337325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3723 | Open in IMG/M |
| 3300015371|Ga0132258_10846827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2307 | Open in IMG/M |
| 3300015371|Ga0132258_10940076 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
| 3300015373|Ga0132257_101648947 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300017787|Ga0183260_10014570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6039 | Open in IMG/M |
| 3300017787|Ga0183260_10560174 | Not Available | 738 | Open in IMG/M |
| 3300017792|Ga0163161_10252203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1376 | Open in IMG/M |
| 3300018054|Ga0184621_10351852 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018061|Ga0184619_10026540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2414 | Open in IMG/M |
| 3300018066|Ga0184617_1032399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1246 | Open in IMG/M |
| 3300018066|Ga0184617_1265576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 515 | Open in IMG/M |
| 3300018073|Ga0184624_10248806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 797 | Open in IMG/M |
| 3300018422|Ga0190265_10021524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5160 | Open in IMG/M |
| 3300018422|Ga0190265_10951581 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300018422|Ga0190265_11042850 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300018422|Ga0190265_11158601 | Not Available | 892 | Open in IMG/M |
| 3300018432|Ga0190275_10000017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 286969 | Open in IMG/M |
| 3300018432|Ga0190275_10465832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1290 | Open in IMG/M |
| 3300018432|Ga0190275_10917521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
| 3300018465|Ga0190269_10737632 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300018465|Ga0190269_11575877 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018466|Ga0190268_10103479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1330 | Open in IMG/M |
| 3300018466|Ga0190268_10428428 | Not Available | 865 | Open in IMG/M |
| 3300018466|Ga0190268_10592042 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300018466|Ga0190268_11002361 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300018469|Ga0190270_10018789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 4198 | Open in IMG/M |
| 3300018469|Ga0190270_10668609 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300018469|Ga0190270_11726852 | Not Available | 680 | Open in IMG/M |
| 3300018469|Ga0190270_12772423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 553 | Open in IMG/M |
| 3300018469|Ga0190270_12911378 | Not Available | 541 | Open in IMG/M |
| 3300018476|Ga0190274_10361974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1386 | Open in IMG/M |
| 3300018476|Ga0190274_11106644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 872 | Open in IMG/M |
| 3300018481|Ga0190271_10008999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6932 | Open in IMG/M |
| 3300018481|Ga0190271_11262275 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300019356|Ga0173481_10065550 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300019356|Ga0173481_10111498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1070 | Open in IMG/M |
| 3300019356|Ga0173481_10218261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 838 | Open in IMG/M |
| 3300019362|Ga0173479_10170522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 890 | Open in IMG/M |
| 3300019377|Ga0190264_11009541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 666 | Open in IMG/M |
| 3300019767|Ga0190267_10940449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 598 | Open in IMG/M |
| 3300020020|Ga0193738_1060323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1132 | Open in IMG/M |
| 3300021184|Ga0196959_10053298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 846 | Open in IMG/M |
| 3300022756|Ga0222622_10190478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1354 | Open in IMG/M |
| 3300022756|Ga0222622_10369327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1004 | Open in IMG/M |
| 3300025567|Ga0210076_1045762 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300025792|Ga0210143_1008234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1927 | Open in IMG/M |
| 3300025900|Ga0207710_10468194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 652 | Open in IMG/M |
| 3300025907|Ga0207645_10091323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae | 1958 | Open in IMG/M |
| 3300025920|Ga0207649_11221023 | Not Available | 594 | Open in IMG/M |
| 3300025935|Ga0207709_11019574 | Not Available | 677 | Open in IMG/M |
| 3300025981|Ga0207640_10475684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1035 | Open in IMG/M |
| 3300026041|Ga0207639_10740401 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300026075|Ga0207708_10057681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2962 | Open in IMG/M |
| 3300026118|Ga0207675_101718869 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300027639|Ga0209387_1183535 | Not Available | 566 | Open in IMG/M |
| 3300027809|Ga0209574_10000242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 14941 | Open in IMG/M |
| 3300027886|Ga0209486_10676709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 663 | Open in IMG/M |
| 3300027907|Ga0207428_10016300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6395 | Open in IMG/M |
| 3300027909|Ga0209382_11536002 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300028004|Ga0247705_1003781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1797 | Open in IMG/M |
| 3300028005|Ga0247708_1004459 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300028005|Ga0247708_1031671 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300028007|Ga0247718_1053655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1051 | Open in IMG/M |
| 3300028587|Ga0247828_11012723 | Not Available | 543 | Open in IMG/M |
| 3300028589|Ga0247818_10754928 | Not Available | 677 | Open in IMG/M |
| 3300028705|Ga0307276_10064763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 835 | Open in IMG/M |
| 3300028717|Ga0307298_10102232 | Not Available | 815 | Open in IMG/M |
| 3300028722|Ga0307319_10182394 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300028722|Ga0307319_10321238 | Not Available | 513 | Open in IMG/M |
| 3300028754|Ga0307297_10016377 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
| 3300028796|Ga0307287_10228335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 706 | Open in IMG/M |
| 3300028796|Ga0307287_10393403 | Not Available | 522 | Open in IMG/M |
| 3300028875|Ga0307289_10154887 | Not Available | 942 | Open in IMG/M |
| 3300028875|Ga0307289_10479135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 511 | Open in IMG/M |
| 3300028878|Ga0307278_10250388 | Not Available | 786 | Open in IMG/M |
| 3300031092|Ga0308204_10238910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300031161|Ga0310837_102230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 7347 | Open in IMG/M |
| 3300031228|Ga0299914_10015668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 5999 | Open in IMG/M |
| 3300031229|Ga0299913_10004536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11672 | Open in IMG/M |
| 3300031548|Ga0307408_100340462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae | 1269 | Open in IMG/M |
| 3300031731|Ga0307405_10052365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2537 | Open in IMG/M |
| 3300031731|Ga0307405_11923233 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031852|Ga0307410_10586810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 928 | Open in IMG/M |
| 3300031938|Ga0308175_100365322 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300031995|Ga0307409_100082475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2603 | Open in IMG/M |
| 3300031995|Ga0307409_102937213 | Not Available | 503 | Open in IMG/M |
| 3300032002|Ga0307416_103474162 | Not Available | 527 | Open in IMG/M |
| 3300032005|Ga0307411_12294094 | Not Available | 507 | Open in IMG/M |
| 3300032159|Ga0268251_10043095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1452 | Open in IMG/M |
| 3300033550|Ga0247829_10365508 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300033550|Ga0247829_11479891 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300033551|Ga0247830_11005474 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300034144|Ga0334962_001758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2245 | Open in IMG/M |
| 3300034172|Ga0334913_031780 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300034172|Ga0334913_073863 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.62% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 16.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.46% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 4.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.80% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.80% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.35% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.35% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.35% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.90% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.45% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.45% |
| Plant Biomass | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012531 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06) | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300013013 | Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - Monturaqui | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028004 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-2-W_N | Environmental | Open in IMG/M |
| 3300028005 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-2-W_N | Environmental | Open in IMG/M |
| 3300028007 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_D | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031161 | Sorghum-adapted microbial communities enriched on stacked mutant (SM) sorghum from Joint BioEnergy Institute, Emeryville, California, United States - SM_Day14_5 | Host-Associated | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034144 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNS | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWNP_00142930 | 2067725001 | Soil | MIGTALRPIGHLAAWLVWHTTRVSLLADLKSPRPPHAE |
| CNAas_10073331 | 3300000532 | Quercus Rhizosphere | RSEPMVGTALRPISHLTAWVVWHAMRVSLLADLERPQPPQSA* |
| LJQas_10007214 | 3300000549 | Quercus Rhizosphere | MSNALRPIGHFAAWIVWHSTGVSLLGDLKSPRPPRG* |
| JGI10213J12805_112410223 | 3300000858 | Soil | MVTTALRPLGHLAAWLVWHSMRVSLLHDLERPSPPAD* |
| JGI10216J12902_1094861963 | 3300000956 | Soil | MALRPLSHLTAWIVWHAARVSLLEDLDSPKPPRSA* |
| JGI10216J12902_1118048602 | 3300000956 | Soil | MVNLALRPIGHLAAWLVWHSVRVSLYDDLQRPRPPF* |
| C688J18823_102709802 | 3300001686 | Soil | MVGMALRPLSHLTAWIVWHAARVSLLEDLERPKPPRSA* |
| Ga0055465_100201942 | 3300004013 | Natural And Restored Wetlands | PDMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRAA* |
| Ga0062593_1017697162 | 3300004114 | Soil | RWGTFGSMVGMALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA* |
| Ga0066671_107392762 | 3300005184 | Soil | MARLALRPIGHLTAWLVWHSTRVSLLADLDEPRPPHGED* |
| Ga0068853_1020505232 | 3300005539 | Corn Rhizosphere | GGKLRSMVGMALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA* |
| Ga0058697_100056153 | 3300005562 | Agave | MIAAALRPIGHFAAWLLWHTARVSLLSDLERPRPPHAR* |
| Ga0058697_107995441 | 3300005562 | Agave | MSTALRPFGHLAAWIVWHAMRVSLLDDLDRPRPPHRG* |
| Ga0068854_1001627372 | 3300005578 | Corn Rhizosphere | MVGMALRPISHLTAWIVWHAARVSLLDDLDSPKPPRNA* |
| Ga0068861_1014431174 | 3300005719 | Switchgrass Rhizosphere | WGRFGVMVGMALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSA* |
| Ga0068860_1021036532 | 3300005843 | Switchgrass Rhizosphere | MALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSA* |
| Ga0081538_1000093520 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MIGIALRPIGHLAAWLVWHTTRISILRDLERPRPPA* |
| Ga0081538_100064158 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MVTTALRPFGHIAAWLVWHSMRVSLLGDLERPQPPAD* |
| Ga0081538_100172892 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MVTTALRPFGHLAAWIVWHSMRVSLLGDLERPQPPTD* |
| Ga0081538_100305993 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MIGTALRPIGHLAAWIVWHTTRVSLLSDLEHPRPPHGR* |
| Ga0081538_100331975 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MVGIALRPIGHLAAWLWWHTTRVSLLSDLERPRPPRGS* |
| Ga0081538_100415594 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MIGTALRPIGHLAAWLVWHTTRVSLLSDLERPRPPRDR* |
| Ga0081538_100895862 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MATVFRPIGHIAAWIAWHTMRVSLLDDLERPQPPG* |
| Ga0081538_102134072 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MVTTALRPFGHIAAWVVWHSMRVSLLGDLERPRPPAD* |
| Ga0081538_102913532 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MGSALRPISHLTAWLVWHTMRVSLLDDLERPQPPHAA* |
| Ga0081538_102948152 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MYRGRAMATALRPISHLTAWLVWHAMRVSLLDDLDQPAPPHDA* |
| Ga0075365_100112833 | 3300006038 | Populus Endosphere | VVGIALKPFGHIAAWIVWHAARVSLKDDLERPSPPHAA* |
| Ga0075365_103528752 | 3300006038 | Populus Endosphere | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRSG* |
| Ga0075365_111922031 | 3300006038 | Populus Endosphere | MATAFRPIGHIAAWIVWHATRVSLLADLERPQPPRPG* |
| Ga0066652_1000659392 | 3300006046 | Soil | MVTTALRPIGHLAAWLLWQSMRVSLLDDLDSPRPPGTL* |
| Ga0075432_100127063 | 3300006058 | Populus Rhizosphere | MVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPPGA* |
| Ga0075432_102716122 | 3300006058 | Populus Rhizosphere | MVGMALRPLSHLTAWIVWHATRVSLLEDLESPKPPQNA* |
| Ga0082029_11666164 | 3300006169 | Termite Nest | MVGLALRPISHLTAWLVWHAARVSLLDDLDSPKPPQNA* |
| Ga0075422_102253081 | 3300006196 | Populus Rhizosphere | VMVGMALRPLSHLTAWIVWHATRVSLLEDLESPKPPQNA* |
| Ga0075428_1002351233 | 3300006844 | Populus Rhizosphere | MVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPRNA* |
| Ga0075428_1002843003 | 3300006844 | Populus Rhizosphere | MATAFRPIGHIAAWIVWHAMRVSLLEDLERPQPPRSG* |
| Ga0075428_1004679272 | 3300006844 | Populus Rhizosphere | MVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPQNA* |
| Ga0075428_1009210243 | 3300006844 | Populus Rhizosphere | MVGMALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA* |
| Ga0075421_1000107199 | 3300006845 | Populus Rhizosphere | MVGTALRPLGHLAAWLVWHTVRVSLLRDLERPEPPRDD* |
| Ga0075421_1003393912 | 3300006845 | Populus Rhizosphere | MATALRPFGHIAAWIVWHAMRVSLLDDLDRPAPPG* |
| Ga0075421_1024375623 | 3300006845 | Populus Rhizosphere | MATAFRPIGHIAAWIVWHAMRVSLLDDLDRPQPPAAR* |
| Ga0075430_1001136364 | 3300006846 | Populus Rhizosphere | AFRPIGHIAAWIVWHAMRVSLLEDLERPQPPRSG* |
| Ga0075430_1006726323 | 3300006846 | Populus Rhizosphere | AGVVGIALKPFGHIAAWIVWHAARVSLKDDLERPSPPHAA* |
| Ga0075431_1001891633 | 3300006847 | Populus Rhizosphere | MALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA* |
| Ga0075431_1013050932 | 3300006847 | Populus Rhizosphere | MVGMALRPLSHLTAWIVWHATRVSLLEDLERPKPPQNA* |
| Ga0075429_1016407661 | 3300006880 | Populus Rhizosphere | SMVGMALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA* |
| Ga0079215_101303092 | 3300006894 | Agricultural Soil | MVGMALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA* |
| Ga0079215_102522272 | 3300006894 | Agricultural Soil | MALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA* |
| Ga0079215_105823442 | 3300006894 | Agricultural Soil | MVGTALRPISHLTAWFVWHAMRVSLLEDLESPKPPRSA* |
| Ga0079215_109927682 | 3300006894 | Agricultural Soil | VLGTALRPTSHLTAWLVWHAMRVSLLDDLEQPRPPHTV* |
| Ga0079216_110570282 | 3300006918 | Agricultural Soil | SRGSFASMVGLALGPISHLAAWLVWHAARVSLLADLDSPKPPQSA* |
| Ga0105679_104186402 | 3300007790 | Soil | MGTALRPIGHIAAWIVWHAMRVSLLDDLDRPQPPTAR* |
| Ga0111539_105145211 | 3300009094 | Populus Rhizosphere | SMVGMALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA* |
| Ga0105245_1000318713 | 3300009098 | Miscanthus Rhizosphere | MVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA* |
| Ga0105245_114239263 | 3300009098 | Miscanthus Rhizosphere | GGLEGYLAAVVGTALKPFGHLAAWIVWHAARVSLLDDLKRPSPPHAG* |
| Ga0075418_105368073 | 3300009100 | Populus Rhizosphere | MVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPRNV* |
| Ga0105247_105159222 | 3300009101 | Switchgrass Rhizosphere | MALRPISHLTAWIVWHATRVSLLEDLESPKPPPNA* |
| Ga0114129_131262051 | 3300009147 | Populus Rhizosphere | VVGTALKPFGHLAAWIVWHAARVSLLDDLKRPSPPHAG* |
| Ga0105243_105638703 | 3300009148 | Miscanthus Rhizosphere | MVGMALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA* |
| Ga0105243_108748491 | 3300009148 | Miscanthus Rhizosphere | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPAPPG* |
| Ga0105243_130275222 | 3300009148 | Miscanthus Rhizosphere | MNTALRPFGHLAAWILWHTMRVSVLDDLERPQPPHRG* |
| Ga0111538_117695152 | 3300009156 | Populus Rhizosphere | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPAAR* |
| Ga0105238_105684981 | 3300009551 | Corn Rhizosphere | ALRPLSHLTAWIVWHATRVSLLEDLESPKPPQNA* |
| Ga0126307_1000277111 | 3300009789 | Serpentine Soil | MVRTAFSPISHLAAWILWHTARVSLLRDLDEPEPPHAA* |
| Ga0126307_100120057 | 3300009789 | Serpentine Soil | MYPGGAGWGTFAAMVGMALRPLSHLTAWLVWHAARVSLLDDLDSPSPPQNA* |
| Ga0126307_1001354110 | 3300009789 | Serpentine Soil | MVGLALRPISHLTAWLVWHAARVSLLEDLDRPKPPQNG* |
| Ga0126307_111292971 | 3300009789 | Serpentine Soil | MCQFVRDWGTFAAMVGMALRPLSHLTAWIVWHAARVSLLDDLDSPNPPQNA* |
| Ga0126307_111347392 | 3300009789 | Serpentine Soil | MVGTALKPFGHLAAWILWHTARISLLDDLKRPSPPHAG* |
| Ga0126307_113694632 | 3300009789 | Serpentine Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPQAG* |
| Ga0126307_116986822 | 3300009789 | Serpentine Soil | MVETALRPVSHIAAWLMWHCMRVSLLEDLERPRPPAP* |
| Ga0126313_100200222 | 3300009840 | Serpentine Soil | MVGLALRPISHLTAWLVWHAARVSLLDDLDSPKPPQSA* |
| Ga0126313_100409402 | 3300009840 | Serpentine Soil | MGTALRPFGHIAAWILWHAMRVSLLDDLDRPRPPHPG* |
| Ga0126313_100561702 | 3300009840 | Serpentine Soil | MVGIALRPIGHLAAWLVWHTTRVSLLSDLERPRPPH* |
| Ga0126313_103125222 | 3300009840 | Serpentine Soil | MVGMALRPLSHLTAWIVWHAARVSLLDDLDSPKPPRNA* |
| Ga0126313_104576402 | 3300009840 | Serpentine Soil | MVGLALRPISHLTAWIVWHAARVSLLEDLDSPKPPRN* |
| Ga0126313_116393471 | 3300009840 | Serpentine Soil | MVGTALRPIGHIAAWLVWQTMRVSLLHDLERPRPPQ* |
| Ga0126305_101815383 | 3300010036 | Serpentine Soil | MGTALRPISHIAAWILWHSMRVSLLDDLERPRPPHPH* |
| Ga0126305_110762331 | 3300010036 | Serpentine Soil | MVGLALRPISHLTAWLVWHAARVSLLEDLDSPKPPPNA* |
| Ga0126315_105348652 | 3300010038 | Serpentine Soil | MVGTALRPIGHFAAWLVWHTMRVSLLHDLERPRPPHAAGE* |
| Ga0126315_109923451 | 3300010038 | Serpentine Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPEPPHPE* |
| Ga0126309_100437832 | 3300010039 | Serpentine Soil | MLRTAFRPVRHVTAWLVWHAAGVSLLEDLEQPRPPS* |
| Ga0126309_100592512 | 3300010039 | Serpentine Soil | MVGMALRPLSHLTAWIVWHAARVSLLEDLESPEPPRNA* |
| Ga0126309_101000963 | 3300010039 | Serpentine Soil | MVGTALRPISHLTAWVVWHAIRVSLLEDLERPEPPQSA* |
| Ga0126309_103509271 | 3300010039 | Serpentine Soil | MGTALRPIGHIAAWIVWHAMRVSLLDDLDRPRPPAS* |
| Ga0126309_105265822 | 3300010039 | Serpentine Soil | MVGMALRPLSHLTAWIVWHAARVSLLEDLDSPNPPRNA* |
| Ga0126309_105295752 | 3300010039 | Serpentine Soil | MVGLALKPFSHLAAWLVWHSMRVSLLEDLDAPSPPT* |
| Ga0126309_108422882 | 3300010039 | Serpentine Soil | MGIALRPIGHIAAWILWQAMRVSLLDDLERPSPPQVR* |
| Ga0126309_108566542 | 3300010039 | Serpentine Soil | MARYALRPISHLAAWLVWHSTRVSLLADLDEPRPPQPEE* |
| Ga0126308_100242572 | 3300010040 | Serpentine Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPHPG* |
| Ga0126308_101744192 | 3300010040 | Serpentine Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLDRPQPPQG* |
| Ga0126308_103844442 | 3300010040 | Serpentine Soil | MVGTALKPLGHLAAWIVWHAARVSLLHDLERPSPPRAG* |
| Ga0126312_1000002635 | 3300010041 | Serpentine Soil | VIAEAMVTTALRPIGHLAAWLLWQSMRVSLLDDLESPKPPGGA* |
| Ga0126312_1000050612 | 3300010041 | Serpentine Soil | MVSLALRPIGHLAAWLVWHAARVSLLDDLEQPRPPY* |
| Ga0126312_100090547 | 3300010041 | Serpentine Soil | MVGMALRPLSHLTAWIVWHATRVSLLEDLESPRPPQNA* |
| Ga0126312_111309562 | 3300010041 | Serpentine Soil | MLGSMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPNPPRNA* |
| Ga0126314_103385623 | 3300010042 | Serpentine Soil | MATALRPIGHIAAWIVWHAMRVSLLDDLERPQPPHVG* |
| Ga0126314_105501602 | 3300010042 | Serpentine Soil | MATALRPIGHIAAWIVWHAMRVSLLDDLERPAPPG* |
| Ga0126314_111599092 | 3300010042 | Serpentine Soil | MCQFVRDWGTFAAMVGMALRPLSHLTPWIVWHAARVSLLEDLDSPNPPQNA* |
| Ga0126310_101060204 | 3300010044 | Serpentine Soil | MATALRPIGHIAAWLVWHAMRVSLLDDLDRPAPP* |
| Ga0126310_108356843 | 3300010044 | Serpentine Soil | MVGMALRPLSHLTAWLVWHAARVSLLDDLDSPSPPQNA* |
| Ga0134127_120853222 | 3300010399 | Terrestrial Soil | MALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA* |
| Ga0134123_123797792 | 3300010403 | Terrestrial Soil | MVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPPTA* |
| Ga0138513_1000055962 | 3300011000 | Soil | MVGMALRPLSHLTAWIVWHATRVSLLDDLDSPKPPQNA* |
| Ga0138513_1000119793 | 3300011000 | Soil | MVVSALRPIGHIAAWLVWHSTRVSLLRDLEEPQPPAG* |
| Ga0136627_10816683 | 3300012042 | Polar Desert Sand | MVILRPIEHIAAWVVWHSTRVSLLDDLDDPSPPES* |
| Ga0136623_101508883 | 3300012045 | Polar Desert Sand | MVSHALRATSHLTAWIVWHSLRVSLLDDLEDPHPPSEA* |
| Ga0136625_10498863 | 3300012091 | Polar Desert Sand | MVSHALRATSHLTAWIVWHSLRVSLLDDLEDPRPPSEA* |
| Ga0136619_101091142 | 3300012185 | Polar Desert Sand | MVFHALRATSHLTAWIVWHSLRVSLLDDLEDPHPPSEA* |
| Ga0136620_100055274 | 3300012186 | Polar Desert Sand | MVSHALRATSHLTAWIVWHSLRVSLLDDLDEPRPPEEA* |
| Ga0136622_103283542 | 3300012187 | Polar Desert Sand | MVSHALRATSHLTAWIVWHSLRVSLLDDLDDPRPPAEA* |
| Ga0137374_100976012 | 3300012204 | Vadose Zone Soil | MVGLALRPISHLTAWIVWHAARVSLLEDLDSPKPPQNA* |
| Ga0136630_10683323 | 3300012529 | Polar Desert Sand | MVFHALRATSHLTAWIVWHSLRVSLLDDLEDPRPPSEA* |
| Ga0136640_100962252 | 3300012531 | Polar Desert Sand | VIAMVRTAFRPVRHVTAWLLWHAAGVSLLEDLEQPR |
| Ga0157309_103078752 | 3300012895 | Soil | MATALRPFGHLAAWIVWHAMRVSLLDDLERPAPPG* |
| Ga0157283_101057712 | 3300012907 | Soil | MALRPLSHLTAWIVWHAARVSLLEDLDSPKPPPGA* |
| Ga0157302_105031792 | 3300012915 | Soil | MSTALRPFGHLAAWIVWHAMRVSLLDDLERPQPPHRG* |
| Ga0162650_1000727071 | 3300012939 | Soil | STAVAGRVGVMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA* |
| Ga0169969_10152353 | 3300013013 | Rock | MVIFRPIGHLAAWIVWHSARVSLLDDLEAPSPPAA* |
| Ga0075322_11376241 | 3300014311 | Natural And Restored Wetlands | MATALRPIGHIAAWIVWHAMRVSLLDDLEGPAPPG* |
| Ga0075316_11333732 | 3300014314 | Natural And Restored Wetlands | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRAA* |
| Ga0157380_118973861 | 3300014326 | Switchgrass Rhizosphere | VVGIALKPFGHIAAWIVWHAVRVSLKDDLERPSPPHAA* |
| Ga0182000_104253632 | 3300014487 | Soil | MVGLALRPISHLTAWIVWHATRVSLLEDLDSPKPPQNA* |
| Ga0182000_105051003 | 3300014487 | Soil | VAAMVTTALRPFGHIAAWLVWHSMRVSLLGDLERPQPPAD* |
| Ga0182001_103092952 | 3300014488 | Soil | MVGLALKPFSHVAAWLVWHSMRVSLLDDLDVPSPPS* |
| Ga0182001_105834582 | 3300014488 | Soil | MVGMALRPISHLTAWIVWHAARVSLLDDLDSPKPPQNA* |
| Ga0173483_105953001 | 3300015077 | Soil | GMALRPLSHLTAWIVWHAARVSLLEDLDSPSPPRNA* |
| Ga0132258_103373252 | 3300015371 | Arabidopsis Rhizosphere | MALRPLSHLTAWIVWHATRVSLLEDLESPKPPQNA* |
| Ga0132258_108468272 | 3300015371 | Arabidopsis Rhizosphere | MVGMALRPLSHLTAWIVWHATRVSLLEDLESPKPPPNA* |
| Ga0132258_109400762 | 3300015371 | Arabidopsis Rhizosphere | MATALRPFGHIAAWIVWHAVRVSLLDDLDRPAPPG* |
| Ga0132257_1016489471 | 3300015373 | Arabidopsis Rhizosphere | MVGSALRPFGHLAAWLVWHAARVSILRDLDRPEPPHVA* |
| Ga0183260_100145705 | 3300017787 | Polar Desert Sand | MVSHALRATSHLTAWIVWHSLRVSLLDDLDEPRPPEEA |
| Ga0183260_105601741 | 3300017787 | Polar Desert Sand | MVSHALRATSHLTAWIVWHSLRVSLLDDLEDPRPPSEA |
| Ga0163161_102522031 | 3300017792 | Switchgrass Rhizosphere | PFVRSWGRFGVMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA |
| Ga0184621_103518521 | 3300018054 | Groundwater Sediment | FRTMVGMALRPLSHLTAWIVWHAARVSLLEDLESPRPPKNA |
| Ga0184619_100265401 | 3300018061 | Groundwater Sediment | MVGMALRPISHLTAWIVWHAARVSLLDDLDRPKPPQNA |
| Ga0184617_10323993 | 3300018066 | Groundwater Sediment | MVETALRPVSHLAAWLMWHCMRVSLLEDLERPRPPAP |
| Ga0184617_12655762 | 3300018066 | Groundwater Sediment | MVASALRPIGHIAAWLVWHSTRVSLLRDLEEPQPPAG |
| Ga0184624_102488062 | 3300018073 | Groundwater Sediment | MVVSALRPIGHIAAWLLWHSTRVSLLRDLEEPQPPAG |
| Ga0190265_100215242 | 3300018422 | Soil | MVGMALRPISHLTAWIVWHAARVSLLEDLDRPRPPKNA |
| Ga0190265_109515813 | 3300018422 | Soil | MVGNALKPFGHLAAWLVWHSMRVSLLDDLDAPQPPS |
| Ga0190265_110428503 | 3300018422 | Soil | MVGMALRPLSHLTAWIVWHAARVSLLEDLDSPNPPRNA |
| Ga0190265_111586012 | 3300018422 | Soil | MVETALRPVSHIAAWLMWHCMRVSLLDDLERPRPPGD |
| Ga0190275_1000001736 | 3300018432 | Soil | MVTNAFRPIGHIAAWIVWHSTGVSLLRDLEAPQPPRD |
| Ga0190275_104658323 | 3300018432 | Soil | MVGYALKPIGHIAAWLVWHATRVSLLDDLDAPEPPS |
| Ga0190275_109175212 | 3300018432 | Soil | MVGTAFKPIGHLAAWIVWHATRVSLLDDLKRPQPPRRT |
| Ga0190269_107376323 | 3300018465 | Soil | MVAPLRPIGHLAAWIVWHSMRVSLLDDLDRPCPPSG |
| Ga0190269_115758772 | 3300018465 | Soil | WRQMVETALRPVSHIAAWLMWHCMRVSLLEDLERPRPPAP |
| Ga0190268_101034792 | 3300018466 | Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRSG |
| Ga0190268_104284282 | 3300018466 | Soil | MVGLALRPISHLTAWLVWHAARVSLLDDLDSPKPPQNA |
| Ga0190268_105920422 | 3300018466 | Soil | MVETALRPVSHIAAWLMWHCMRVSLLEDLERPRPPAP |
| Ga0190268_110023612 | 3300018466 | Soil | MVGMALRPLSHLTAWIVWHAARVSLLDDLDSPSPPA |
| Ga0190270_100187896 | 3300018469 | Soil | MVTTALRPFGHIAAWLVWHSMRVSLLEDLERPEPPVG |
| Ga0190270_106686091 | 3300018469 | Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPKPPQSA |
| Ga0190270_117268522 | 3300018469 | Soil | MLGYFRTMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPKNA |
| Ga0190270_127724232 | 3300018469 | Soil | MGTAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPHPG |
| Ga0190270_129113781 | 3300018469 | Soil | MVGTALRPLGHLAAWLVWHAARVSLLRDLERPEPPHGA |
| Ga0190274_103619742 | 3300018476 | Soil | MVTTALRPFGHIAAWLVWHSMRVSLLEDRERPEPPVG |
| Ga0190274_111066442 | 3300018476 | Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLEHPQPPHPG |
| Ga0190271_100089992 | 3300018481 | Soil | MGTALRPISHLTAWLVWHAMRVSLLDDLERPAPPHDV |
| Ga0190271_112622751 | 3300018481 | Soil | MVGYALKPIGHIAAWLVWHATRVSLLEDLDSPDPPS |
| Ga0173481_100655502 | 3300019356 | Soil | VVGTALKPFGHLAAWIVWHAARVSLLDDLKRPSPPHAG |
| Ga0173481_101114982 | 3300019356 | Soil | MALRPLSHLTAWIVWHAARVSLLEDLESPKPPRNA |
| Ga0173481_102182611 | 3300019356 | Soil | RSMVGMALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA |
| Ga0173479_101705221 | 3300019362 | Soil | MVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPRNA |
| Ga0190264_110095412 | 3300019377 | Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPHPG |
| Ga0190267_109404492 | 3300019767 | Soil | MVETALRPVSHIAAWLMWHCTRVSLLEYLERPRPPAP |
| Ga0193738_10603232 | 3300020020 | Soil | MVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPKNA |
| Ga0196959_100532982 | 3300021184 | Soil | MALRPISHLTAWIVWHAARVSLLEDLDRPRPPKNA |
| Ga0222622_101904783 | 3300022756 | Groundwater Sediment | MVETALRPLSHLAAWLMWHCMRVSLLEDLERPRPPAP |
| Ga0222622_103693272 | 3300022756 | Groundwater Sediment | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPEPPHPS |
| Ga0210076_10457622 | 3300025567 | Natural And Restored Wetlands | PDMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRAA |
| Ga0210143_10082342 | 3300025792 | Natural And Restored Wetlands | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRAA |
| Ga0207710_104681942 | 3300025900 | Switchgrass Rhizosphere | MVGMALRPISHLTAWIVWHATRVSLLEDLESPKPPPNA |
| Ga0207645_100913234 | 3300025907 | Miscanthus Rhizosphere | MVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA |
| Ga0207649_112210231 | 3300025920 | Corn Rhizosphere | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPAPPG |
| Ga0207709_110195742 | 3300025935 | Miscanthus Rhizosphere | MNTALRPFGHLAAWILWHTMRVSVLDDLERPQPPHRG |
| Ga0207640_104756842 | 3300025981 | Corn Rhizosphere | MALRPISHLTAWIVWHAARVSLLDDLDSPKPPRNA |
| Ga0207639_107404013 | 3300026041 | Corn Rhizosphere | GGKLRSMAGMALRPIAHLTAWIVWHAARVSLLDDLDAPSPPRNA |
| Ga0207708_100576812 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGMALRPISHLTAWIVWHAARVSLLDDLDSPKPPRNA |
| Ga0207675_1017188693 | 3300026118 | Switchgrass Rhizosphere | MALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSA |
| Ga0209387_11835352 | 3300027639 | Agricultural Soil | MVGMALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA |
| Ga0209574_1000024217 | 3300027809 | Agave | MATAFRPIGHIAAWIVWHATRVSLLDDLERPQPPHPG |
| Ga0209486_106767092 | 3300027886 | Agricultural Soil | MGTALRPISHLTAWLVWHAMRVSLLDDLDQPAPPHDA |
| Ga0207428_100163003 | 3300027907 | Populus Rhizosphere | MVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPPGA |
| Ga0209382_115360021 | 3300027909 | Populus Rhizosphere | VVGIALKPFGHIAAWIVWHAARVSLKDDLERPSPPHAA |
| Ga0247705_10037813 | 3300028004 | Soil | MVTMALRATGHLTAWLVWHSSRVSLLEDLDEPQPPAAA |
| Ga0247708_10044593 | 3300028005 | Soil | MVTLALRPIGHLAAWLVWHSTRISLLDDLDSPRPPDAG |
| Ga0247708_10316711 | 3300028005 | Soil | YGGRMVSTALRPIGHLAAWLVWQSSRISLLGELDSPRPPGAD |
| Ga0247718_10536551 | 3300028007 | Soil | MVSTALRPIGHLAAWLVWQSSRISLLGELDSPRPPGAD |
| Ga0247828_110127231 | 3300028587 | Soil | MATAFRPIGHIAAWIVWHAVRVSLLDDLDRPQPPQHG |
| Ga0247818_107549282 | 3300028589 | Soil | MALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSS |
| Ga0307276_100647632 | 3300028705 | Soil | MATALRPIGHIAAWLVWHAMRVSLLDDLDRPAPPG |
| Ga0307298_101022322 | 3300028717 | Soil | MVGLALRPISHLTAWIVWHAARVSLLEDLESPKPPRNA |
| Ga0307319_101823942 | 3300028722 | Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPQAG |
| Ga0307319_103212382 | 3300028722 | Soil | MVGVALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA |
| Ga0307297_100163773 | 3300028754 | Soil | MGTALRPIGHIAAWIVWHAMRVSLLDDLDRPRPPAS |
| Ga0307287_102283352 | 3300028796 | Soil | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPG |
| Ga0307287_103934032 | 3300028796 | Soil | GTFDSMVGLALRPISHLTAWIVWHAARVSLLEDLESPKPPRNA |
| Ga0307289_101548872 | 3300028875 | Soil | SVERWGTFDSMVGLALRPISHLTAWIVWHAARVSLLEDLESPKPPRNA |
| Ga0307289_104791352 | 3300028875 | Soil | MVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPRSA |
| Ga0307278_102503881 | 3300028878 | Soil | MVGLALRPISHLTAWIVWHAARVSLLDDLDSPKPP |
| Ga0308204_102389101 | 3300031092 | Soil | VGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA |
| Ga0310837_1022304 | 3300031161 | Plant Biomass | MVTWALKPLGHLAAWLLWHTSRISVLEDLDSPRPPASE |
| Ga0299914_100156687 | 3300031228 | Soil | MANALRPIGHLAAWIVWRSTGVSLLDDLERPQPPGG |
| Ga0299913_100045364 | 3300031229 | Soil | MGTALRPISHLTAWLVWHAMRVSLLDDLEQPRPPHSA |
| Ga0299913_100551003 | 3300031229 | Soil | VVIFRPIGHITAWLVWHSLRVSLLDDLDKPEPPAAA |
| Ga0307408_1003404622 | 3300031548 | Rhizosphere | MATALRPIGHIAAWIVWHAMRVSLLDDLERPQPPEAG |
| Ga0307405_100523654 | 3300031731 | Rhizosphere | MATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPEAG |
| Ga0307405_119232331 | 3300031731 | Rhizosphere | MVGLALRPISHLTAWIVWHAARVSLLEDLDSPKPPQNA |
| Ga0307410_105868101 | 3300031852 | Rhizosphere | MVGTALKPLGHLAAWIVWHAARVSLLHDLERPSPPRAG |
| Ga0308175_1003653222 | 3300031938 | Soil | MATALRPFGHIAAWIVWHAVRVSLLDDLDRPAPPG |
| Ga0307409_1000824752 | 3300031995 | Rhizosphere | MALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA |
| Ga0307409_1029372132 | 3300031995 | Rhizosphere | MATALRPIGHIAAWIVWHAMRVSLLDDLDRPAPPG |
| Ga0307416_1034741621 | 3300032002 | Rhizosphere | PMVGMALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA |
| Ga0307411_122940942 | 3300032005 | Rhizosphere | MATAFRPIGHIAAWIVWHAMRVSLLDDLDRPQPPQ |
| Ga0268251_100430953 | 3300032159 | Agave | MIAAALRPIGHFAAWLLWHTARVSLLSDLERPRPPHAR |
| Ga0247829_103655081 | 3300033550 | Soil | GRFGGMVGMALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSA |
| Ga0247829_114798912 | 3300033550 | Soil | MATAFRPIGHIAAWIVWHAIRVSLLDDLERPQPPG |
| Ga0247830_110054741 | 3300033551 | Soil | MALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA |
| Ga0334962_001758_1025_1168 | 3300034144 | Sub-Biocrust Soil | MYVGLQDSVMIGTALRPISHVAAWIVWHSMKVSLLDDLDAPRPPGEA |
| Ga0334913_031780_357_482 | 3300034172 | Sub-Biocrust Soil | MVNVATTALRPIGHVAAWLVWHSLRVSLLEDLDSPRPPQAS |
| Ga0334913_073863_106_228 | 3300034172 | Sub-Biocrust Soil | MVGNALRATSHLAAWLVWTSMRVSLFDDLDAPQPPLRQQG |
| ⦗Top⦘ |