| Basic Information | |
|---|---|
| Family ID | F018722 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 233 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLPATAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCD |
| Number of Associated Samples | 170 |
| Number of Associated Scaffolds | 233 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.13 % |
| % of genes near scaffold ends (potentially truncated) | 98.71 % |
| % of genes from short scaffolds (< 2000 bps) | 98.71 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.515 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.888 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.622 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (71.674 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 0.00% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 233 Family Scaffolds |
|---|---|---|
| PF00011 | HSP20 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 233 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.52 % |
| All Organisms | root | All Organisms | 39.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003692|Ga0007426_1022271 | Not Available | 694 | Open in IMG/M |
| 3300004099|Ga0058900_1430191 | Not Available | 777 | Open in IMG/M |
| 3300004103|Ga0058903_1024803 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 652 | Open in IMG/M |
| 3300004115|Ga0058890_181784 | Not Available | 652 | Open in IMG/M |
| 3300004119|Ga0058887_1030204 | Not Available | 777 | Open in IMG/M |
| 3300004120|Ga0058901_1004540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 739 | Open in IMG/M |
| 3300004121|Ga0058882_1017803 | Not Available | 754 | Open in IMG/M |
| 3300004136|Ga0058889_1012787 | Not Available | 502 | Open in IMG/M |
| 3300004138|Ga0058905_1033869 | Not Available | 766 | Open in IMG/M |
| 3300004139|Ga0058897_10052632 | Not Available | 587 | Open in IMG/M |
| 3300004475|Ga0068969_1068623 | Not Available | 729 | Open in IMG/M |
| 3300004476|Ga0068966_1038188 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
| 3300004478|Ga0068972_1037150 | Not Available | 732 | Open in IMG/M |
| 3300004505|Ga0068941_1000430 | Not Available | 695 | Open in IMG/M |
| 3300004620|Ga0068957_1072242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 748 | Open in IMG/M |
| 3300004631|Ga0058899_10160570 | Not Available | 651 | Open in IMG/M |
| 3300004631|Ga0058899_10190755 | Not Available | 513 | Open in IMG/M |
| 3300004956|Ga0072326_1116845 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 695 | Open in IMG/M |
| 3300004970|Ga0072320_1005880 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 699 | Open in IMG/M |
| 3300005650|Ga0075038_10220196 | Not Available | 554 | Open in IMG/M |
| 3300006423|Ga0075039_1065059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 511 | Open in IMG/M |
| 3300006426|Ga0075037_1198774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 749 | Open in IMG/M |
| 3300007327|Ga0075016_1015242 | Not Available | 717 | Open in IMG/M |
| 3300010144|Ga0115593_1121435 | Not Available | 573 | Open in IMG/M |
| 3300010144|Ga0115593_1392837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 603 | Open in IMG/M |
| 3300010152|Ga0126318_10314634 | Not Available | 508 | Open in IMG/M |
| 3300010152|Ga0126318_11037783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 812 | Open in IMG/M |
| 3300010859|Ga0126352_1168380 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 703 | Open in IMG/M |
| 3300010860|Ga0126351_1027022 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 781 | Open in IMG/M |
| 3300010864|Ga0126357_1214003 | Not Available | 606 | Open in IMG/M |
| 3300010865|Ga0126346_1174578 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 500 | Open in IMG/M |
| 3300010866|Ga0126344_1052663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 648 | Open in IMG/M |
| 3300011014|Ga0138596_115524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 671 | Open in IMG/M |
| 3300011015|Ga0138535_106812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 772 | Open in IMG/M |
| 3300011019|Ga0138557_100648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 801 | Open in IMG/M |
| 3300011020|Ga0138602_109944 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 670 | Open in IMG/M |
| 3300011021|Ga0138529_103360 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 507 | Open in IMG/M |
| 3300011022|Ga0138536_124901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 734 | Open in IMG/M |
| 3300011035|Ga0138542_142994 | Not Available | 678 | Open in IMG/M |
| 3300011038|Ga0138547_121824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 779 | Open in IMG/M |
| 3300011039|Ga0138593_120063 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300011040|Ga0138587_136077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 670 | Open in IMG/M |
| 3300011042|Ga0138586_143197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
| 3300011044|Ga0138545_123612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 503 | Open in IMG/M |
| 3300011046|Ga0138600_109567 | Not Available | 514 | Open in IMG/M |
| 3300011046|Ga0138600_131808 | Not Available | 756 | Open in IMG/M |
| 3300011056|Ga0138538_1028443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 778 | Open in IMG/M |
| 3300011057|Ga0138544_1099497 | Not Available | 739 | Open in IMG/M |
| 3300011060|Ga0138583_1087251 | Not Available | 749 | Open in IMG/M |
| 3300011064|Ga0138525_1019799 | Not Available | 794 | Open in IMG/M |
| 3300011079|Ga0138569_1094514 | Not Available | 572 | Open in IMG/M |
| 3300011084|Ga0138562_1036075 | Not Available | 804 | Open in IMG/M |
| 3300011086|Ga0138564_1111189 | Not Available | 527 | Open in IMG/M |
| 3300011088|Ga0138576_1250095 | Not Available | 781 | Open in IMG/M |
| 3300011120|Ga0150983_10801022 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 533 | Open in IMG/M |
| 3300011120|Ga0150983_13104471 | Not Available | 652 | Open in IMG/M |
| 3300011120|Ga0150983_14519382 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 615 | Open in IMG/M |
| 3300012212|Ga0150985_117205173 | Not Available | 799 | Open in IMG/M |
| 3300012212|Ga0150985_117206859 | Not Available | 807 | Open in IMG/M |
| 3300012402|Ga0134059_1161930 | Not Available | 696 | Open in IMG/M |
| 3300012469|Ga0150984_114120333 | Not Available | 833 | Open in IMG/M |
| 3300012778|Ga0138269_1057710 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 738 | Open in IMG/M |
| 3300012778|Ga0138269_1166842 | Not Available | 746 | Open in IMG/M |
| 3300013080|Ga0153913_1161358 | Not Available | 808 | Open in IMG/M |
| 3300013295|Ga0170791_10768472 | Not Available | 734 | Open in IMG/M |
| 3300013295|Ga0170791_14090733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 706 | Open in IMG/M |
| 3300016698|Ga0181503_1094507 | Not Available | 567 | Open in IMG/M |
| 3300016698|Ga0181503_1171774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 512 | Open in IMG/M |
| 3300016700|Ga0181513_1119936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 906 | Open in IMG/M |
| 3300016700|Ga0181513_1143196 | Not Available | 757 | Open in IMG/M |
| 3300016701|Ga0181509_1176432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 789 | Open in IMG/M |
| 3300016702|Ga0181511_1238450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 758 | Open in IMG/M |
| 3300016705|Ga0181507_1002654 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 961 | Open in IMG/M |
| 3300016730|Ga0181515_1197495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 779 | Open in IMG/M |
| 3300016750|Ga0181505_10898130 | Not Available | 782 | Open in IMG/M |
| 3300019158|Ga0184580_103917 | Not Available | 732 | Open in IMG/M |
| 3300019160|Ga0184577_105297 | Not Available | 719 | Open in IMG/M |
| 3300019161|Ga0184602_100113 | Not Available | 796 | Open in IMG/M |
| 3300019161|Ga0184602_111962 | Not Available | 798 | Open in IMG/M |
| 3300019163|Ga0184581_123680 | Not Available | 568 | Open in IMG/M |
| 3300019164|Ga0184582_100359 | Not Available | 723 | Open in IMG/M |
| 3300019165|Ga0184589_109397 | Not Available | 730 | Open in IMG/M |
| 3300019166|Ga0184595_113028 | Not Available | 734 | Open in IMG/M |
| 3300019167|Ga0184571_103659 | Not Available | 515 | Open in IMG/M |
| 3300019170|Ga0184570_111663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 509 | Open in IMG/M |
| 3300019173|Ga0184575_115350 | Not Available | 726 | Open in IMG/M |
| 3300019174|Ga0184579_114988 | Not Available | 600 | Open in IMG/M |
| 3300019174|Ga0184579_121501 | Not Available | 536 | Open in IMG/M |
| 3300019177|Ga0184592_114100 | Not Available | 518 | Open in IMG/M |
| 3300019178|Ga0184583_101264 | Not Available | 717 | Open in IMG/M |
| 3300019185|Ga0184587_103472 | Not Available | 735 | Open in IMG/M |
| 3300019186|Ga0184588_133667 | Not Available | 736 | Open in IMG/M |
| 3300019188|Ga0184599_112951 | Not Available | 770 | Open in IMG/M |
| 3300019199|Ga0187789_1021996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 658 | Open in IMG/M |
| 3300019199|Ga0187789_1188990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 785 | Open in IMG/M |
| 3300019211|Ga0187799_1004173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 505 | Open in IMG/M |
| 3300019240|Ga0181510_1168131 | Not Available | 540 | Open in IMG/M |
| 3300019240|Ga0181510_1254299 | Not Available | 544 | Open in IMG/M |
| 3300019241|Ga0187793_1154939 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 514 | Open in IMG/M |
| 3300019242|Ga0181502_1050892 | Not Available | 569 | Open in IMG/M |
| 3300019242|Ga0181502_1333424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 797 | Open in IMG/M |
| 3300019242|Ga0181502_1372780 | Not Available | 747 | Open in IMG/M |
| 3300019245|Ga0187791_1133625 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 710 | Open in IMG/M |
| 3300019245|Ga0187791_1241558 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 558 | Open in IMG/M |
| 3300019245|Ga0187791_1270058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 757 | Open in IMG/M |
| 3300019245|Ga0187791_1308752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 531 | Open in IMG/M |
| 3300019250|Ga0187790_1029276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 786 | Open in IMG/M |
| 3300019250|Ga0187790_1167023 | Not Available | 561 | Open in IMG/M |
| 3300019250|Ga0187790_1224303 | Not Available | 530 | Open in IMG/M |
| 3300019250|Ga0187790_1242686 | Not Available | 593 | Open in IMG/M |
| 3300019250|Ga0187790_1383157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 507 | Open in IMG/M |
| 3300019250|Ga0187790_1383723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 602 | Open in IMG/M |
| 3300019251|Ga0187795_1064106 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300019258|Ga0181504_1177656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 567 | Open in IMG/M |
| 3300019258|Ga0181504_1234477 | Not Available | 734 | Open in IMG/M |
| 3300019260|Ga0181506_1475516 | Not Available | 544 | Open in IMG/M |
| 3300019260|Ga0181506_1488246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 746 | Open in IMG/M |
| 3300019263|Ga0184647_1069141 | Not Available | 786 | Open in IMG/M |
| 3300019264|Ga0187796_1143652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 600 | Open in IMG/M |
| 3300019264|Ga0187796_1153814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300019264|Ga0187796_1168733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 642 | Open in IMG/M |
| 3300019264|Ga0187796_1627076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 543 | Open in IMG/M |
| 3300019265|Ga0187792_1031281 | Not Available | 748 | Open in IMG/M |
| 3300019265|Ga0187792_1064612 | Not Available | 689 | Open in IMG/M |
| 3300019265|Ga0187792_1114777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 778 | Open in IMG/M |
| 3300019268|Ga0181514_1124343 | Not Available | 817 | Open in IMG/M |
| 3300019270|Ga0181512_1017607 | Not Available | 766 | Open in IMG/M |
| 3300019270|Ga0181512_1059776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 799 | Open in IMG/M |
| 3300019270|Ga0181512_1497477 | Not Available | 727 | Open in IMG/M |
| 3300019273|Ga0187794_1722447 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 758 | Open in IMG/M |
| 3300019275|Ga0187798_1010599 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 776 | Open in IMG/M |
| 3300019275|Ga0187798_1130584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 550 | Open in IMG/M |
| 3300019275|Ga0187798_1728203 | Not Available | 794 | Open in IMG/M |
| 3300019278|Ga0187800_1027307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 503 | Open in IMG/M |
| 3300019278|Ga0187800_1547020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 685 | Open in IMG/M |
| 3300019284|Ga0187797_1381302 | Not Available | 721 | Open in IMG/M |
| 3300019284|Ga0187797_1476252 | Not Available | 796 | Open in IMG/M |
| 3300020070|Ga0206356_10088084 | Not Available | 713 | Open in IMG/M |
| 3300021286|Ga0179583_1021765 | Not Available | 691 | Open in IMG/M |
| 3300021307|Ga0179585_1027732 | Not Available | 754 | Open in IMG/M |
| 3300021307|Ga0179585_1079484 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 760 | Open in IMG/M |
| 3300021315|Ga0179958_1002701 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 760 | Open in IMG/M |
| 3300021857|Ga0213849_1107735 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 718 | Open in IMG/M |
| 3300021860|Ga0213851_1567255 | Not Available | 746 | Open in IMG/M |
| 3300021860|Ga0213851_1604715 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 595 | Open in IMG/M |
| 3300021861|Ga0213853_10685301 | Not Available | 619 | Open in IMG/M |
| 3300021909|Ga0213846_1040537 | Not Available | 506 | Open in IMG/M |
| 3300022498|Ga0242644_1012857 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 772 | Open in IMG/M |
| 3300022498|Ga0242644_1013231 | Not Available | 765 | Open in IMG/M |
| 3300022498|Ga0242644_1030887 | Not Available | 575 | Open in IMG/M |
| 3300022499|Ga0242641_1028160 | Not Available | 603 | Open in IMG/M |
| 3300022499|Ga0242641_1030671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 587 | Open in IMG/M |
| 3300022500|Ga0242643_106254 | Not Available | 790 | Open in IMG/M |
| 3300022501|Ga0242645_1009435 | Not Available | 755 | Open in IMG/M |
| 3300022501|Ga0242645_1013119 | Not Available | 677 | Open in IMG/M |
| 3300022501|Ga0242645_1016297 | Not Available | 629 | Open in IMG/M |
| 3300022502|Ga0242646_1014514 | Not Available | 696 | Open in IMG/M |
| 3300022505|Ga0242647_1012892 | Not Available | 770 | Open in IMG/M |
| 3300022506|Ga0242648_1075883 | Not Available | 554 | Open in IMG/M |
| 3300022506|Ga0242648_1098842 | Not Available | 507 | Open in IMG/M |
| 3300022508|Ga0222728_1036603 | Not Available | 781 | Open in IMG/M |
| 3300022508|Ga0222728_1054637 | Not Available | 679 | Open in IMG/M |
| 3300022509|Ga0242649_1021783 | Not Available | 772 | Open in IMG/M |
| 3300022510|Ga0242652_1038281 | Not Available | 575 | Open in IMG/M |
| 3300022511|Ga0242651_1036862 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 569 | Open in IMG/M |
| 3300022512|Ga0242676_1014134 | Not Available | 769 | Open in IMG/M |
| 3300022512|Ga0242676_1014909 | Not Available | 757 | Open in IMG/M |
| 3300022523|Ga0242663_1101374 | Not Available | 574 | Open in IMG/M |
| 3300022525|Ga0242656_1035481 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
| 3300022525|Ga0242656_1081896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 607 | Open in IMG/M |
| 3300022527|Ga0242664_1064412 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 696 | Open in IMG/M |
| 3300022528|Ga0242669_1045395 | Not Available | 736 | Open in IMG/M |
| 3300022528|Ga0242669_1092538 | Not Available | 576 | Open in IMG/M |
| 3300022530|Ga0242658_1251928 | Not Available | 500 | Open in IMG/M |
| 3300022531|Ga0242660_1080342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 767 | Open in IMG/M |
| 3300022531|Ga0242660_1091912 | Not Available | 730 | Open in IMG/M |
| 3300022532|Ga0242655_10106402 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 777 | Open in IMG/M |
| 3300022532|Ga0242655_10108771 | Not Available | 771 | Open in IMG/M |
| 3300022708|Ga0242670_1019051 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300022708|Ga0242670_1038704 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 643 | Open in IMG/M |
| 3300022708|Ga0242670_1057267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalbus → Thioalbus denitrificans | 569 | Open in IMG/M |
| 3300022708|Ga0242670_1083840 | Not Available | 504 | Open in IMG/M |
| 3300022711|Ga0242674_1016797 | Not Available | 822 | Open in IMG/M |
| 3300022713|Ga0242677_1024902 | Not Available | 766 | Open in IMG/M |
| 3300022714|Ga0242671_1042973 | Not Available | 727 | Open in IMG/M |
| 3300022715|Ga0242678_1075581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 528 | Open in IMG/M |
| 3300022716|Ga0242673_1040156 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 754 | Open in IMG/M |
| 3300022717|Ga0242661_1051534 | Not Available | 770 | Open in IMG/M |
| 3300022718|Ga0242675_1040926 | Not Available | 744 | Open in IMG/M |
| 3300022718|Ga0242675_1045386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 720 | Open in IMG/M |
| 3300022718|Ga0242675_1089789 | Not Available | 577 | Open in IMG/M |
| 3300022721|Ga0242666_1062343 | Not Available | 807 | Open in IMG/M |
| 3300022722|Ga0242657_1126713 | Not Available | 653 | Open in IMG/M |
| 3300022724|Ga0242665_10161748 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 714 | Open in IMG/M |
| 3300022726|Ga0242654_10151078 | Not Available | 776 | Open in IMG/M |
| 3300022726|Ga0242654_10204688 | Not Available | 688 | Open in IMG/M |
| 3300023541|Ga0247544_102644 | Not Available | 516 | Open in IMG/M |
| 3300023547|Ga0247554_105604 | Not Available | 533 | Open in IMG/M |
| 3300023551|Ga0247546_106679 | Not Available | 500 | Open in IMG/M |
| 3300023552|Ga0247551_104612 | Not Available | 556 | Open in IMG/M |
| 3300023553|Ga0247524_109467 | Not Available | 758 | Open in IMG/M |
| 3300023656|Ga0247547_101128 | Not Available | 760 | Open in IMG/M |
| 3300023672|Ga0247553_103244 | Not Available | 788 | Open in IMG/M |
| 3300028450|Ga0189898_1013428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 814 | Open in IMG/M |
| 3300029701|Ga0222748_1038628 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 779 | Open in IMG/M |
| 3300030520|Ga0311372_10811081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1277 | Open in IMG/M |
| 3300030712|Ga0307921_1015387 | Not Available | 804 | Open in IMG/M |
| 3300030718|Ga0307919_1038898 | Not Available | 654 | Open in IMG/M |
| 3300030730|Ga0307482_1094539 | Not Available | 808 | Open in IMG/M |
| 3300030730|Ga0307482_1105478 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 776 | Open in IMG/M |
| 3300030730|Ga0307482_1109047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 767 | Open in IMG/M |
| 3300030806|Ga0265731_103520 | Not Available | 562 | Open in IMG/M |
| 3300030824|Ga0265726_106938 | Not Available | 510 | Open in IMG/M |
| 3300030835|Ga0265725_102916 | Not Available | 559 | Open in IMG/M |
| 3300030863|Ga0265766_1017347 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 571 | Open in IMG/M |
| 3300030876|Ga0265730_102401 | Not Available | 607 | Open in IMG/M |
| 3300030877|Ga0265777_107107 | Not Available | 775 | Open in IMG/M |
| 3300030877|Ga0265777_114581 | Not Available | 608 | Open in IMG/M |
| 3300031040|Ga0265754_1007302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
| 3300031231|Ga0170824_101617958 | Not Available | 662 | Open in IMG/M |
| 3300031633|Ga0310108_126592 | Not Available | 502 | Open in IMG/M |
| 3300031663|Ga0307484_119127 | Not Available | 510 | Open in IMG/M |
| 3300031810|Ga0316044_124330 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 604 | Open in IMG/M |
| 3300031817|Ga0316046_105255 | Not Available | 711 | Open in IMG/M |
| 3300031870|Ga0316029_108155 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 569 | Open in IMG/M |
| 3300031870|Ga0316029_110986 | Not Available | 511 | Open in IMG/M |
| 3300031871|Ga0316036_119367 | Not Available | 505 | Open in IMG/M |
| 3300032515|Ga0348332_14281646 | Not Available | 530 | Open in IMG/M |
| 3300032739|Ga0315741_11663121 | Not Available | 567 | Open in IMG/M |
| 3300034667|Ga0314792_129746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 656 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.17% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 13.30% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.01% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.58% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.29% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.29% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.86% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.43% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.43% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.43% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.43% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003692 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Bulk_42 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004115 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF216 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004119 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF210 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004136 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF214 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004138 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF246 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004505 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 29 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004620 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004956 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 43 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004970 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006423 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007327 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010144 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011014 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 43 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011015 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 13 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011019 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 38 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011020 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 78 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011021 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 7 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011022 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 14 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011035 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 23 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011038 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 28 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011039 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 20 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011040 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 79 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011042 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 76 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011044 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 26 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011046 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 68 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011056 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 16 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011057 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011060 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013080 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016701 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019158 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019160 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019163 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019164 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019165 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019166 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019167 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019170 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019173 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019174 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019178 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019185 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019199 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019211 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021286 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021909 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - NH:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023541 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023551 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023553 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023656 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028450 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030564 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030712 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030718 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030806 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030824 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030835 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030876 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030976 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031663 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031817 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031870 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031871 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032739 | Forest Soil Metatranscriptomics Site 2 LB Combined Assembly | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0007426_10222711 | 3300003692 | Avena Fatua Rhizosphere | MVPAVAVARLQGRAAPAATFLSPVAREYPSRALAGFFIPP |
| Ga0058900_14301911 | 3300004099 | Forest Soil | MPANAVARMEGKAAPAATLLSPVARDYPSRALVGFFIPPRCDC |
| Ga0058903_10248032 | 3300004103 | Forest Soil | VPSATVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCDCS |
| Ga0058890_1817841 | 3300004115 | Forest Soil | MTPAKELVIVPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCDC |
| Ga0058887_10302042 | 3300004119 | Forest Soil | MLPAIAVARTEGRMAPAAIFLSPVARDYPSRALEGFQAFALRLF |
| Ga0058901_10045402 | 3300004120 | Forest Soil | MVPITAVARVAGEGGTSATFLSPVARDYPSRALEGFFRPSRC |
| Ga0058882_10178032 | 3300004121 | Forest Soil | VIVPAAAVARMEGRAAPAATFLSPVARDYPSRAREGFFRP |
| Ga0058889_10127872 | 3300004136 | Forest Soil | LPAKRIAAYEGIAAPAATILSPVARDYPSRAFEGFFRPSRCD |
| Ga0058905_10338691 | 3300004138 | Forest Soil | MTPAKELVIVPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSS |
| Ga0058897_100526322 | 3300004139 | Forest Soil | MPAIAVARVEGKAAPAATLLSPVARDYPSRALDGFFIPPRCDCS |
| Ga0068969_10686231 | 3300004475 | Peatlands Soil | MLPAGAVARVEGRTAPAAAFLSPVARDYPSRALEGFFRPSRC |
| Ga0068966_10381882 | 3300004476 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFNGFFIPPRCDCS |
| Ga0068972_10371501 | 3300004478 | Peatlands Soil | MLPAGAVARVEGRTAPAAAFLSPVARDYPSRALEGFQAFAL |
| Ga0068941_10004302 | 3300004505 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFNGFFIPPR |
| Ga0068957_10722422 | 3300004620 | Peatlands Soil | MLPAGAVARVEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDC |
| Ga0058899_101605702 | 3300004631 | Forest Soil | VPSNTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCDY |
| Ga0058899_101907551 | 3300004631 | Forest Soil | MLPATAVARMEGVTAPAAASLSPVARDYPSRALEGFQAFALRLF |
| Ga0072326_11168451 | 3300004956 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFNGFFIPPRC |
| Ga0072320_10058801 | 3300004970 | Peatlands Soil | MLPAGAVARVEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCD |
| Ga0075038_102201961 | 3300005650 | Permafrost Soil | VPVEAVARSEGRAAPAAAYLSPVARDYPSRALGVFFSPP |
| Ga0075039_10650591 | 3300006423 | Permafrost Soil | MTPAKELVKCLSTAVARVGGEGSTSCSILSPVARDYPSRALVEFFIPPRCDC |
| Ga0075037_11987741 | 3300006426 | Permafrost Soil | VPATAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDCS |
| Ga0075016_10152421 | 3300007327 | Watersheds | VILPAAAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRP |
| Ga0115593_11214351 | 3300010144 | Wetland | VPAVAACAASEGRAAPAATDLSPVTRAYLSRALEDFFQGLRAA |
| Ga0115593_13928371 | 3300010144 | Wetland | MPAAARAAEGTPAPVAAVLSPVARDYPSRALNGFFMSLRCGC |
| Ga0126318_103146341 | 3300010152 | Soil | VIYACLAVARLEGTMEPASIAHSPVTRDYPSRALGGFFRPPRCDC |
| Ga0126318_110377831 | 3300010152 | Soil | VIYAFTVAVSRLKGPTAPAAVDLSPVARDYPNRAFVGFFIPPR |
| Ga0126352_11683802 | 3300010859 | Boreal Forest Soil | VILPHTAVARMEGRAAPAATFLSPVARDYPSRALEGFFRPPRFDC |
| Ga0126351_10270221 | 3300010860 | Boreal Forest Soil | VILPHTAVARMEGRAAPAATFLSPVARDYPSRALEGFFRPPRFDCS |
| Ga0126357_12140032 | 3300010864 | Boreal Forest Soil | MLPATAVARVEGRTAPAAVALSPVARDYPSRALEGFFRPSRCDCS |
| Ga0126346_11745781 | 3300010865 | Boreal Forest Soil | VPAATVARAEGRTAPAAAFLSPVARDYPSRALAGFFIPSRFD |
| Ga0126344_10526631 | 3300010866 | Boreal Forest Soil | VILPHTAVARMEGRAAPAATFLSPVARDYPSRALEGFFRPPRFD |
| Ga0138596_1155241 | 3300011014 | Peatlands Soil | MPAGAVARSEGRTAPAAAFLSPVTRDYPSRALDGFFMPPRCDCYPE |
| Ga0138535_1068121 | 3300011015 | Peatlands Soil | MPAGAVARSEGMTAPAAAFLSPVTRDYPSRALDGFFMPPRC |
| Ga0138557_1006481 | 3300011019 | Peatlands Soil | MPAGAVARSEGRTAPAAAFLSPVTRDYPSRALVGFF |
| Ga0138602_1099441 | 3300011020 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFNGFFIPPRCDC |
| Ga0138529_1033601 | 3300011021 | Peatlands Soil | MLPAGAVARSEGRTAPAAAFLSPVTRDYPSRALDGFFMPPRCDC |
| Ga0138536_1249011 | 3300011022 | Peatlands Soil | MPAGAVARSEGRTAPAAAFLSPVTRDYPSRALDGFFMPPRCDC |
| Ga0138542_1429941 | 3300011035 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFNGFFIP |
| Ga0138547_1218241 | 3300011038 | Peatlands Soil | MPAGAVARSEGRTAPAAAFLSPVTRDYPSRALVGFFMPPRCDCS |
| Ga0138593_1200631 | 3300011039 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVAWDYPSRAFNGFFIPQRCDC |
| Ga0138587_1360771 | 3300011040 | Peatlands Soil | MPAGAVARSEGMTAPAAAFLSPVTRDYPSRALDGFFMPPRCDCS |
| Ga0138586_1431971 | 3300011042 | Peatlands Soil | MPAFAVARSEGRTAPAAAFLSPVTRDYPSRALDGFFMPPRCDCS |
| Ga0138545_1236121 | 3300011044 | Peatlands Soil | MPAGAVARSEGRTAPAAAFLSPVTRDYPSRALDGFFMPPRCD |
| Ga0138600_1095671 | 3300011046 | Peatlands Soil | MPAGAVARSEGMTAPAAAFLSPVTRDYPSRALDGF |
| Ga0138600_1318081 | 3300011046 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFEGFFRPS |
| Ga0138538_10284431 | 3300011056 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFNGFFIPPRCD |
| Ga0138544_10994971 | 3300011057 | Peatlands Soil | MLPAIAVARTEGRMAPAAIFLSPVARDYPSRALVGFFSPPRCDC |
| Ga0138583_10872511 | 3300011060 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVTRDYPSRAFEGVFRPSRCGC |
| Ga0138525_10197991 | 3300011064 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYLSRDFEGVFRPS |
| Ga0138569_10945141 | 3300011079 | Peatlands Soil | MLPAIAVARTEGRMAPAAIFLSPVARDYPSRALEGFFRPSRCDCS |
| Ga0138562_10360751 | 3300011084 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFKGFFIPPRC |
| Ga0138564_11111891 | 3300011086 | Peatlands Soil | MLPAIAVARTEGRMAPAAIFLSPVARDYPSRALEGFFRPSRCDC |
| Ga0138576_12500951 | 3300011088 | Peatlands Soil | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFNGFF |
| Ga0150983_108010221 | 3300011120 | Forest Soil | MLPASAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPPRCDC |
| Ga0150983_131044711 | 3300011120 | Forest Soil | VILPATAVARVEGMTAPAAAFLSPVARDYPGRALEGFFRSSRCDCS |
| Ga0150983_145193821 | 3300011120 | Forest Soil | VPAAAVARMEGRAAPAATFLSPVARDYPSRAREGFFRPSRCDCS |
| Ga0150985_1172051731 | 3300012212 | Avena Fatua Rhizosphere | MVPAAAVARVQGRAAPAATFLSPVAREYPSRALAGFFIPPRCDCS |
| Ga0150985_1172068592 | 3300012212 | Avena Fatua Rhizosphere | MVPAVAVARLQGRAAPAATFLSPVAREYPSRALAGFFIPPRCDCSRSE |
| Ga0134059_11619301 | 3300012402 | Grasslands Soil | MPVTAVARVEGKAAPAATLLSPVARDYPSRALDGFFHSAAMR |
| Ga0150984_1141203331 | 3300012469 | Avena Fatua Rhizosphere | MVPAVAVARLQGRAAPAATFLSPVAREYPSRALAGFFIPPRCDC |
| Ga0138269_10577101 | 3300012778 | Freshwater Lake | VIFAFPAVARLKGMVAPAAAVLSPVARDYPNRALDGFFRPSRSRL |
| Ga0138269_11668421 | 3300012778 | Freshwater Lake | MVPAAAVARMEGRTAPAAAFLSPVARDYPSRAFDEFFIPPRNG |
| Ga0153913_11613581 | 3300013080 | Freshwater Wetlands | MLTAVARVQGTAAPAAAFLSPVAREYPSRALDGFFMPPRCV |
| Ga0170791_107684721 | 3300013295 | Freshwater | MVPAAAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRP |
| Ga0170791_140907331 | 3300013295 | Freshwater | VPATAVARVKGTAAPAATILSPVTRDYPSRALEGFFRPSHCDCS |
| Ga0181503_10945071 | 3300016698 | Peatland | VILPATAVARMEGRTAPAAAFLSPVAREYPSRALEGFFRP |
| Ga0181503_11717741 | 3300016698 | Peatland | MPSDAVARTEGRAAPAAAVLSPVARDYPSRALDGFFRPPRCDCS |
| Ga0181513_11199361 | 3300016700 | Peatland | MPSAAVARTEGRAAPAAAFLSPVARDYPSRALDGFFIPPRCD |
| Ga0181513_11431961 | 3300016700 | Peatland | MLPATAVARMEGRTAPAAAFLSPVAREYPSRALEGFFRPPRCDC |
| Ga0181509_11764321 | 3300016701 | Peatland | MPSAAVARTEGRAAPAAAFLSPVARDYPSRALDGF |
| Ga0181511_12384501 | 3300016702 | Peatland | MPSGAVARSEGRTAPAAAFLSPVTRDYPSRALDGFFMPPRCDC |
| Ga0181507_10026543 | 3300016705 | Peatland | AAFAVSEEMAAPAAAFLSPVARDYPSRAFAVFFITSRSLRLAHL |
| Ga0181515_11974951 | 3300016730 | Peatland | MPSAAVARTEGRAAPAAAFLSPVARDYPSRALDGFF |
| Ga0181505_108981301 | 3300016750 | Peatland | MPVTAVARVEGRAAPAAAVLSPVARDYPSRAFNGF |
| Ga0184580_1039171 | 3300019158 | Soil | VILPVTAVARVEGRAAPAAAFLSPVARDYLSRALGGFFRPPRHD |
| Ga0184577_1052971 | 3300019160 | Soil | MLPATAVARMEGRTAPAAAFLSPVAREYPSRALEGFFRP |
| Ga0184602_1001131 | 3300019161 | Soil | VIVPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCD |
| Ga0184602_1119621 | 3300019161 | Soil | MLPATAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCD |
| Ga0184581_1236801 | 3300019163 | Soil | MLPAIAVARMEGRTAPAAVALSPVARDYPSRALEGFFRPSRCDC |
| Ga0184582_1003591 | 3300019164 | Soil | VISPAVAVARVEGRTAPAAAFLSPVARDYPSRALEGFFRP |
| Ga0184589_1093971 | 3300019165 | Soil | MLPATAVARMEGRTAPAAAFLSPVAREYPSRALEGFFRPPRCD |
| Ga0184595_1130281 | 3300019166 | Soil | VILPVTAVARVEGRAAPAAAFLSPVTRDYLSRALGGFFRPPRHD |
| Ga0184571_1036591 | 3300019167 | Soil | MLPATAVARMEGRTAPAAVALSPVARDYPSRALGGFFRPPRCD |
| Ga0184570_1116631 | 3300019170 | Soil | MLPATAVARMEGRTAPAAVFLSPVARDYPSRALEGFFRPSRCDCS |
| Ga0184575_1153501 | 3300019173 | Soil | VPAAAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDC |
| Ga0184579_1149881 | 3300019174 | Soil | MLPAIAVARMEGRTAPAAVALSPVARDYPSRALEGFFRPSRCD |
| Ga0184579_1215011 | 3300019174 | Soil | VILPVTAVARVEGRAAPAAAFLSPVARDYLSRALGGFFRPPRHDC |
| Ga0184592_1141001 | 3300019177 | Soil | VILPAAAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDC |
| Ga0184583_1012641 | 3300019178 | Soil | MLPAIAVARTEGRTAPAAVALSPVARDYPSRALEGFFRP |
| Ga0184587_1034721 | 3300019185 | Soil | MLPATAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDCS |
| Ga0184588_1336671 | 3300019186 | Soil | MLPATAVARMEGRAAPAAAFLSPVAREYPSRALEGFFRPPRCDCS |
| Ga0184599_1129511 | 3300019188 | Soil | VIVPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRC |
| Ga0187789_10219961 | 3300019199 | Peatland | MVPASAVARVQGRAAPAAVLLSPVAREYPSRALDGFFMPPRCDC |
| Ga0187789_11889902 | 3300019199 | Peatland | MPAAAVARTEGRAAPAAAILSPVARDYPSRALGGFFMPPRCD |
| Ga0187799_10041731 | 3300019211 | Peatland | MPAAAVARTEGRAAPAAAVLSPVARDYPSRALDGFFMPPRCD |
| Ga0181510_11681311 | 3300019240 | Peatland | MLPSTAVARMEGVTAPAAASLSPVARDYPSRALEGFFRPSRCDCS |
| Ga0181510_12542991 | 3300019240 | Peatland | MCLPRAAFAVSEEMAAPAAAFLSPVARDYPSRAFAVFFITSRSR |
| Ga0187793_11549391 | 3300019241 | Peatland | MLPAVAVARMEGRTAPAAAFLSPVARDYPSRAFDGFFMPPRCDC |
| Ga0181502_10508921 | 3300019242 | Peatland | VILPATAVARMEGIAAPAATILSPVARDYPSRVREGFFRP |
| Ga0181502_13334241 | 3300019242 | Peatland | MPSAAVARTEGRAAPAAAFLSPVARDYPSRALDGFFIPPRC |
| Ga0181502_13727801 | 3300019242 | Peatland | MCLPRAAFAVSEEMAAPAAAFLSPVARDYPSRAFAVFFITSRSRLF |
| Ga0187791_11336251 | 3300019245 | Peatland | MPAGAVARMEGRAAPAAAVLSPVARDYPSRAFNGFFIPPRCDC |
| Ga0187791_12415581 | 3300019245 | Peatland | MPSAAVARAEGRATPAAAFLSPVARDYPSRALDGFFMPPRCD |
| Ga0187791_12700581 | 3300019245 | Peatland | MPSAAVARTEGRAAPAAAVLSPVARDYPSRALDGFFMPPRCD |
| Ga0187791_13087521 | 3300019245 | Peatland | MPFAAVSRAKGRAAPAAAVLSPVARDYPSRALDGFFMPPRCD |
| Ga0187790_10292761 | 3300019250 | Peatland | MPSAAVARTEGRAAPAAAVLSPVARDYPSRALDGFFMPPRCDC |
| Ga0187790_11670231 | 3300019250 | Peatland | MVPGIAVARMQGRAAPAAAFHSPVAREYPSRALEGFFRPSRCDCS |
| Ga0187790_12243031 | 3300019250 | Peatland | MVPASAVARVQGRAAPAAVLLSPVAREYPSRALDGFFMPPRCDCS |
| Ga0187790_12426861 | 3300019250 | Peatland | MPVSAVARMEGRAAPAAAVLSPVARDYPSRALDGFFIPPRCDC |
| Ga0187790_13831571 | 3300019250 | Peatland | MPAAAVARTEGRTAPAATFLSPVARDYPSRAFDGFFMPPRCDC |
| Ga0187790_13837231 | 3300019250 | Peatland | MPAAAVARTEGRAAPAAAILSPVARDYPSRALGGFFMPPRCDC |
| Ga0187790_14985441 | 3300019250 | Peatland | MCLPPSLARAEETPAPAAVILSPVTRDYPSRAFGGFFIPPRCDCS |
| Ga0187795_10641061 | 3300019251 | Peatland | MVPASAVARVQGRAAPAAAFLSPVAREYPSRALDGFFMPPRCD |
| Ga0181504_11776561 | 3300019258 | Peatland | MPSAAVARTEGRAAPAAAFLSPVARDYPSRALGGFQAPALRQP |
| Ga0181504_12344771 | 3300019258 | Peatland | MLPAIAVARTEGRTAPAAVALSPVARDYPSRALEGFFRPSRCDC |
| Ga0181506_14755161 | 3300019260 | Peatland | VPANAVARMEGTAAPAATILSPVARDYPSRALEGVFRPSRC |
| Ga0181506_14882461 | 3300019260 | Peatland | MPSAAVARTEGRAAPAAAFLSPVARDYPSRALDGFFIP |
| Ga0184647_10691411 | 3300019263 | Groundwater Sediment | MPDTAVARVEGRAAPAAAVLSPVARDYPSRALAGFFIPPRCDCS |
| Ga0187796_11436521 | 3300019264 | Peatland | MPAEAVARSEGRAAPAAAFHSPVARDYPSRALDGFFMPPRCD |
| Ga0187796_11538141 | 3300019264 | Peatland | MPAGAVARMEGRAAPAAAVLSPVARDYPSRAFNGFFIPPRCDCS |
| Ga0187796_11687331 | 3300019264 | Peatland | MPAGAVARAEGRTAPAAAFLSPVTRDYPSRALDGFFMPPRCDCS |
| Ga0187796_16270761 | 3300019264 | Peatland | MPSGAVARAEGRAAPAAAFLSPVTRDYPSRALDGFFMPPRCDCS |
| Ga0187792_10312811 | 3300019265 | Peatland | MVPASAVARVQGRAAPAAAFLSPVAREYPSRALDGFF |
| Ga0187792_10646121 | 3300019265 | Peatland | MPAGAVARMEGRAAPAAAVLSPVARDYPSRAFNGFF |
| Ga0187792_11147771 | 3300019265 | Peatland | MPSAAVARTEGRAAPAAAVLSPVARDYPSRALDGFFMPPRCDCS |
| Ga0181514_11243431 | 3300019268 | Peatland | VISACHAVARLEGTPAPAAVALSPVTRDYPSRAFEGFFRSSRCDCE |
| Ga0181512_10176071 | 3300019270 | Peatland | VITACPAVTRVEERAAPAAAFLSPVARDYPSRAFEGFFRSSRLG |
| Ga0181512_10597761 | 3300019270 | Peatland | MPSDAVARTEGRAAPAAAVLSPVARDYPSRALDGFFRPPRC |
| Ga0181512_14974771 | 3300019270 | Peatland | VPANAVARMEGTAAPAATILSPVARDYPSRAREGFFRPSHCD |
| Ga0187794_17224471 | 3300019273 | Peatland | MPSGAVARAEGRAAPAAAFLSPVTRDYPSRALDGFFMPPRCDC |
| Ga0187798_10105992 | 3300019275 | Peatland | MRSAAVARAKGRVAPAAAFLSPVARDYPSRALDGFFMPPR |
| Ga0187798_11305841 | 3300019275 | Peatland | MPAIAVARMEGRAAPAAAVLSPVARDYPSRALDGFFSPPRCDCS |
| Ga0187798_17282031 | 3300019275 | Peatland | MLPAIAVARTEGRMAPAAIFLSPVARDHPSRALEGFFRPSRCDCS |
| Ga0187800_10273071 | 3300019278 | Peatland | MPAAAVARTEGTTAPAAAILSPVTRDYPSRALDGFFMPPRCDRS |
| Ga0187800_15470201 | 3300019278 | Peatland | MPSGAVARAEGRAAPAAAFLSPVTRDYPSRALDGFFMPPRCDCSI |
| Ga0187797_13813021 | 3300019284 | Peatland | MPTGAVARMEGKAAPAAAVLSPVARDYPSRAFNGFFIPPRCDC |
| Ga0187797_14762521 | 3300019284 | Peatland | MLPAIAVARTEGRMAPAAIFLSPVARDYPSRALEGFFRPSR |
| Ga0206356_100880841 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MVPAAAVARVQGRAAPAATFLSPVAREYPSRALAGFFIPPRCDC |
| Ga0179583_10217651 | 3300021286 | Vadose Zone Soil | MPFTAVARVEGRVAPAAAVLSPVARDYPSRAHSGFFIPPRC |
| Ga0179585_10277321 | 3300021307 | Vadose Zone Soil | VIYAYQLAVARVEGKAAPAATLLSPVARDYPSRALDGFFIPPR |
| Ga0179585_10794841 | 3300021307 | Vadose Zone Soil | MPATAVARVEGRAAPAATFLSPVARDYPSRALDGFFIPPRFDC |
| Ga0179958_10027011 | 3300021315 | Vadose Zone Soil | MPATAVARVEGRAAPAATFLSPVARDYPSRALDGFFIPPR |
| Ga0213849_11077351 | 3300021857 | Watersheds | MCLPTAVARVEGRAAPAAAILSPVARDYPSRALEGFFRPPRCDC |
| Ga0213851_15672551 | 3300021860 | Watersheds | VPSATVARVKGTAAPAATILSPVARDYPSRALEGFF |
| Ga0213851_16047151 | 3300021860 | Watersheds | MVPAAAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDC |
| Ga0213853_106853012 | 3300021861 | Watersheds | VPSTTVARVKGTAAPAATILSPVARDYPSRALEGFF |
| Ga0213846_10405371 | 3300021909 | Watersheds | MLPAIAVARTEGRMAPAAIFLSPVARDYPSRALEGFFRPSRCD |
| Ga0242644_10128571 | 3300022498 | Soil | VIVPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCDC |
| Ga0242644_10132311 | 3300022498 | Soil | VIYACLAVARLEGMMEPASIALSPVARDYPSRALGGFFRPPRFDC |
| Ga0242644_10308871 | 3300022498 | Soil | LPATAVARMEGKAAPAAAFLSPVARDYPSRALVEFFIPPRFDC |
| Ga0242641_10281601 | 3300022499 | Soil | MLPATAVARMEGGTAPAAASLSPVARDYPSRALEGFFRSSRC |
| Ga0242641_10306711 | 3300022499 | Soil | VPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCDCSIKERS |
| Ga0242643_1062542 | 3300022500 | Soil | VIYACLAVARLEGMMEPASIALSPVARDYPSRALGGFFRPPRFH |
| Ga0242645_10094351 | 3300022501 | Soil | VILPATAVARMEGMAAPAATILSPVARDYPSRVREGFFRPSHCD |
| Ga0242645_10131191 | 3300022501 | Soil | VILPAAAVVRMEGRTAPAAAFLSPIARDYPSRALEGFFRP |
| Ga0242645_10162971 | 3300022501 | Soil | RLKGRAAPAATFLSPVARDYPSCALGGFFRPPRLNQKFE |
| Ga0242646_10145142 | 3300022502 | Soil | VPATAVARLKGTAAPAATILSPVTRDYPSRALEGFFRPSHC |
| Ga0242647_10128922 | 3300022505 | Soil | VILPASAVARMEGRAAPAATILSPVARDYPSRVREGFFRPSHCD |
| Ga0242648_10758831 | 3300022506 | Soil | VIYACLAVARLEGMMEPASIALSPVARDYPSRALGGFF |
| Ga0242648_10988421 | 3300022506 | Soil | MPGTAVARVEGRAAPAAAVLSPVARDYPSRALNGFFIPPRCD |
| Ga0222728_10366031 | 3300022508 | Soil | MPATAVACVEGKAAPAATLLSPVARDYPSRALVGFFIPPRCDCS |
| Ga0222728_10546372 | 3300022508 | Soil | VIVPATAVARVKGTAAPAATILSPVTRDYPSRALEGFFRPS |
| Ga0242649_10217831 | 3300022509 | Soil | VPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCD |
| Ga0242652_10382811 | 3300022510 | Soil | VPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCDCS |
| Ga0242651_10368621 | 3300022511 | Soil | MLPAVAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDCS |
| Ga0242676_10141341 | 3300022512 | Soil | VPATAVARVKGTAAPAATILSPVTRDYPSRALEGFFRPSHCDC |
| Ga0242676_10149091 | 3300022512 | Soil | VILPATAVARMEGMAAPAATILSPVARDYPSRVREGFFRPSHCDC |
| Ga0242663_11013741 | 3300022523 | Soil | VPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCDC |
| Ga0242656_10354811 | 3300022525 | Soil | VILPAGVVARVQGRAKPAFAILSPVARDYLSRALGGFFRPPRFDCSIKEPA |
| Ga0242656_10818961 | 3300022525 | Soil | MLPAGAVARVEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDCS |
| Ga0242664_10644121 | 3300022527 | Soil | MLPAVAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDC |
| Ga0242669_10453951 | 3300022528 | Soil | LPAAVVARVQGRAKPAFAILSPVARDYLSRALGGFF |
| Ga0242669_10925381 | 3300022528 | Soil | MLPAIAVARTEGRMAPAAIFLSPVARDYPSRALEGFFRPSRC |
| Ga0242658_12519281 | 3300022530 | Soil | VPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSR |
| Ga0242660_10803421 | 3300022531 | Soil | VILPAAAVARVQGRAKPAFAFLSPVARDYLSRALGGFFRPPRFDC |
| Ga0242660_10919121 | 3300022531 | Soil | MPANAVARMEGKAAPAATLLSPVARDYPSRALVGFFIPPRC |
| Ga0242655_101064021 | 3300022532 | Soil | VILPAAVVARVQGRAKPAFAILSPVARDYLSRALGGFFRPPRFDC |
| Ga0242655_101087711 | 3300022532 | Soil | VPSNTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCD |
| Ga0242670_10190511 | 3300022708 | Soil | LPATAVARVEGKAAPAATFLSPVARDYPSRALVEFFIPPRCDC |
| Ga0242670_10387041 | 3300022708 | Soil | LPAAAVARVQGRAKPAFAILSPVARDYPIRAVVGFFRPPRF |
| Ga0242670_10572671 | 3300022708 | Soil | VIVPAAAVARMEGRAAPAAATLSPVARDYPSRALEGFFRPSRC |
| Ga0242670_10838401 | 3300022708 | Soil | MPNTAVARVEGKVAPAATLLSPVARDYPSRALDGFFIPPRCD |
| Ga0242674_10167972 | 3300022711 | Soil | VPSNTVARVKGTAAPAATILSPVARDYLSRALAGFFSPSRFRLFRSAATGL |
| Ga0242677_10249021 | 3300022713 | Soil | VPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSS |
| Ga0242671_10429732 | 3300022714 | Soil | VPATAVARVKGTAAPAATILSPVTRDYPSRALEGFFRPSHCD |
| Ga0242678_10755811 | 3300022715 | Soil | LPAAVVARVQGRAKPAFAILSPVARDYLSRALGGFFRPPR |
| Ga0242673_10401561 | 3300022716 | Soil | VILPAAVVARVQGRAKPAFAILSPVARDYLSRALGGFFRPPRFD |
| Ga0242661_10515341 | 3300022717 | Soil | VIYACLAVARLEGMMEPASIALSPVARDYPSRALGGFFRPPRFD |
| Ga0242675_10409261 | 3300022718 | Soil | VILPAVAVARVQGRAKPAFAFLSPVARDYLSRALGGFFRPP |
| Ga0242675_10453861 | 3300022718 | Soil | LPAAVVARVQGRAKPAFAILSPVARDYLSRALGGFFRPPRFD |
| Ga0242675_10897891 | 3300022718 | Soil | VPATAVARMEGRTAPAAVFLSPVARDYPSRALEGFFRPSRCDC |
| Ga0242666_10623431 | 3300022721 | Soil | VIVPSNTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRCDC |
| Ga0242657_11267131 | 3300022722 | Soil | MLPAVAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCD |
| Ga0242665_101617481 | 3300022724 | Soil | LPAAVVARVQGRAKPAFAILSPVARDYLSRALGGFFRPPRFDCSIKEP |
| Ga0242654_101510781 | 3300022726 | Soil | MLPAGAVARVEGRTAPAAAFLSPVARDYPSRALGGFF |
| Ga0242654_102046881 | 3300022726 | Soil | VPSTTVARVKGTAAPAATILSPVARDYPSRALEGFFSSSRC |
| Ga0247544_1026441 | 3300023541 | Soil | VILPAVAVARMEGRTAPAAAFLSPVARDYPSRALGGFFRPPRCDC |
| Ga0247554_1056041 | 3300023547 | Soil | MLPATAVARMEGRTAPAAVALSPVARDYPSRALEGFFRPS |
| Ga0247546_1066791 | 3300023551 | Soil | MLPATAVARMEGRAAPAAAFLSPVAREYPSRALEGF |
| Ga0247551_1046121 | 3300023552 | Soil | MLPAIAVARTEGRTAPAAVALSPVARDYPSRALEGFFR |
| Ga0247524_1094672 | 3300023553 | Soil | MLPATAVARMEGRAAPAAAFLSPVAREYPSRALEGFF |
| Ga0247547_1011281 | 3300023656 | Soil | MLPATAVARMEGRAAPAAAFLSPVAREYPSRALEGFFRPPRCDC |
| Ga0247553_1032441 | 3300023672 | Soil | MLPATAVARMEGRTAPDAVFLSPVARDYPSRALEGFFRPSRCD |
| Ga0189898_10134281 | 3300028450 | Peatlands Soil | MPAGAVARSEGMTAPAAAFLSPVTRDYPSRALDGFFMPPRCDCYPE |
| Ga0222748_10386281 | 3300029701 | Soil | VILPASAVARMEGRAAPAATILSPVARDYPSRVREGFFRPSHCDC |
| Ga0311372_108110812 | 3300030520 | Palsa | VPANAVARMEGTAAPAATILSPVARDYPSRALEGFFRPSHCDCSIKE |
| Ga0210256_103026581 | 3300030564 | Soil | VPAVAARAASEERAAPAVAFLSPVARDYPSRAFAGFFSPLRSRL |
| Ga0307921_10153871 | 3300030712 | Soil | VPATAVSRVEGRAAPAATFLSPVARDYPSRALGGTFAPPRFDC |
| Ga0307919_10388981 | 3300030718 | Soil | VIVPATAVSRVEGRAAPAATFLSPVARDYPSRALGGTFAPPRFDC |
| Ga0307482_10945391 | 3300030730 | Hardwood Forest Soil | LPATAVARMEGKAAPAATFLSPVARDYPSRALVEFFIPPRFDC |
| Ga0307482_11054782 | 3300030730 | Hardwood Forest Soil | VILPAAAVARVQGRAKPAFAILSPVARDYLSRALGGFFRPPRFD |
| Ga0307482_11090471 | 3300030730 | Hardwood Forest Soil | VRYAFVMAVPRLKGLAAPAAARLSPVTRDYPSRALVGFFIPPRCGCS |
| Ga0265731_1035201 | 3300030806 | Soil | MLPATAVARMEGGAAPAAATLSPVARDYPSRALEGFFRPSRCDC |
| Ga0265726_1069381 | 3300030824 | Soil | VILPAIAVARMEGLTAPAAAYLSPVARDYPSRALEGFFRPPRCDC |
| Ga0265725_1029161 | 3300030835 | Soil | MLPATAVARMEGGAAPAAATLSPVARDYPSRALEGFFRPSRCD |
| Ga0265766_10173471 | 3300030863 | Soil | LRAVARSKGRAAPAAAYLSPVTRDYPSRALDVFFIPSRFG |
| Ga0265730_1024011 | 3300030876 | Soil | VILPASAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDC |
| Ga0265777_1071071 | 3300030877 | Soil | VILPVTAVARVEGRAAPAAAFLSPVARDYLSRALGG |
| Ga0265777_1145811 | 3300030877 | Soil | VILPAAAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCD |
| Ga0265739_1026711 | 3300030976 | Soil | VPAVAARAASEERAAPAAAFLSPVARDYPSRAFAGFFSPLRSR |
| Ga0265754_10073021 | 3300031040 | Soil | MLPATAVARMEGRTAPAAAFLSPVARDYPSRALGGFFRPPRCDCS |
| Ga0170824_1016179581 | 3300031231 | Forest Soil | VIYACPAVARLEGMMEPASIAHSPVTRDYPSRALGGVFRPPRCDCAIK |
| Ga0310108_1265921 | 3300031633 | Soil | VIVPSTTVARVKGTAAPAATILSPVARDYPSRAREGFFRPSHCD |
| Ga0307484_1191271 | 3300031663 | Hardwood Forest Soil | MLPATAVARMEGGTAPAAASLSPVARDYPSRALGGFFRPPRCDCS |
| Ga0316044_1243301 | 3300031810 | Soil | MLPATAVARMEGRAAPAAAFLSPVAREYPSRALEGFFRPPRCD |
| Ga0316046_1052551 | 3300031817 | Soil | MLPATAVARMEGRTAPAAVALSPVARDYPSRALEG |
| Ga0316029_1081551 | 3300031870 | Soil | VPAAAVARMEGRTAPAAAFLSPVARDYPSRALGGFFRPPRCDC |
| Ga0316029_1109861 | 3300031870 | Soil | MLPAIAVARMEGRTAPAAVALSPVARDYPNRALEGFFRPSRCDC |
| Ga0316036_1193671 | 3300031871 | Soil | MLPAIAVARTEGRTAPAAVALSPVARDYPNRALEGFFRPS |
| Ga0348332_142816461 | 3300032515 | Plant Litter | MLPATAVARMEGRTAPAAVALSPVARDYPSRALEGFFRPPRCDC |
| Ga0315741_116631211 | 3300032739 | Forest Soil | VILPAAAVARMEGRTAPAAAFLSPVARDYPSRALEGFFRPSRCDCSIK |
| Ga0314792_129746_3_131 | 3300034667 | Soil | MPLDDFRRQEGRVAPAATSLSPVTREYPNRALGYHFRPPRCDC |
| ⦗Top⦘ |