| Basic Information | |
|---|---|
| Family ID | F018233 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 236 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MVGIVVVTRAALLIARRASTWTIDEHLGGLSPECVAVDLRGPTQVY |
| Number of Associated Samples | 187 |
| Number of Associated Scaffolds | 236 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.03 % |
| % of genes near scaffold ends (potentially truncated) | 96.61 % |
| % of genes from short scaffolds (< 2000 bps) | 91.53 % |
| Associated GOLD sequencing projects | 178 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.186 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.644 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.729 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.492 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.27% β-sheet: 14.86% Coil/Unstructured: 64.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 236 Family Scaffolds |
|---|---|---|
| PF13602 | ADH_zinc_N_2 | 19.07 |
| PF12680 | SnoaL_2 | 15.25 |
| PF01047 | MarR | 9.75 |
| PF05368 | NmrA | 6.78 |
| PF00126 | HTH_1 | 4.66 |
| PF05199 | GMC_oxred_C | 4.24 |
| PF11154 | DUF2934 | 2.97 |
| PF13561 | adh_short_C2 | 2.12 |
| PF03466 | LysR_substrate | 2.12 |
| PF13460 | NAD_binding_10 | 1.69 |
| PF03358 | FMN_red | 1.69 |
| PF01161 | PBP | 1.27 |
| PF12802 | MarR_2 | 0.85 |
| PF13411 | MerR_1 | 0.42 |
| PF07366 | SnoaL | 0.42 |
| PF13249 | SQHop_cyclase_N | 0.42 |
| PF08240 | ADH_N | 0.42 |
| PF00881 | Nitroreductase | 0.42 |
| PF02518 | HATPase_c | 0.42 |
| PF00069 | Pkinase | 0.42 |
| PF12840 | HTH_20 | 0.42 |
| PF13683 | rve_3 | 0.42 |
| PF13450 | NAD_binding_8 | 0.42 |
| PF16859 | TetR_C_11 | 0.42 |
| PF00037 | Fer4 | 0.42 |
| PF06580 | His_kinase | 0.42 |
| PF00248 | Aldo_ket_red | 0.42 |
| PF13243 | SQHop_cyclase_C | 0.42 |
| PF06057 | VirJ | 0.42 |
| PF13354 | Beta-lactamase2 | 0.42 |
| PF00440 | TetR_N | 0.42 |
| PF07859 | Abhydrolase_3 | 0.42 |
| PF02525 | Flavodoxin_2 | 0.42 |
| PF00107 | ADH_zinc_N | 0.42 |
| PF03551 | PadR | 0.42 |
| PF13426 | PAS_9 | 0.42 |
| PF13564 | DoxX_2 | 0.42 |
| PF02627 | CMD | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 236 Family Scaffolds |
|---|---|---|---|
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 4.24 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.69 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.27 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.42 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.42 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.42 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.42 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.42 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.42 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.42 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.42 |
| COG3946 | Type IV secretory pathway, VirJ component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.19 % |
| Unclassified | root | N/A | 3.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908009|FWIRA_GRAM18401EHPEI | Not Available | 508 | Open in IMG/M |
| 3300000955|JGI1027J12803_100186230 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300000955|JGI1027J12803_100960150 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
| 3300000955|JGI1027J12803_102487498 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 775 | Open in IMG/M |
| 3300000955|JGI1027J12803_108355545 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300001867|JGI12627J18819_10070854 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300002561|JGI25384J37096_10135085 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300002568|C688J35102_118294705 | Not Available | 546 | Open in IMG/M |
| 3300005174|Ga0066680_10606195 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005176|Ga0066679_10214234 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300005178|Ga0066688_10174082 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300005179|Ga0066684_10010134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 4524 | Open in IMG/M |
| 3300005293|Ga0065715_10473717 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005332|Ga0066388_106694422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus cereus group → Bacillus thuringiensis | 580 | Open in IMG/M |
| 3300005353|Ga0070669_101754549 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005354|Ga0070675_101471567 | Not Available | 628 | Open in IMG/M |
| 3300005355|Ga0070671_100109681 | All Organisms → cellular organisms → Bacteria | 2318 | Open in IMG/M |
| 3300005434|Ga0070709_10927876 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005440|Ga0070705_101249936 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005468|Ga0070707_101557308 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005526|Ga0073909_10449193 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005540|Ga0066697_10134629 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300005540|Ga0066697_10783818 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005542|Ga0070732_10811918 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005545|Ga0070695_100708609 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005546|Ga0070696_101747728 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005547|Ga0070693_100963007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300005549|Ga0070704_100897985 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005576|Ga0066708_11016702 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005587|Ga0066654_10289422 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005764|Ga0066903_100633697 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300005841|Ga0068863_102508063 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006047|Ga0075024_100334834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300006050|Ga0075028_100220409 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300006052|Ga0075029_100881738 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300006173|Ga0070716_101410377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300006354|Ga0075021_10449029 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300006755|Ga0079222_10648654 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium F42-01 | 820 | Open in IMG/M |
| 3300006844|Ga0075428_100594879 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300006844|Ga0075428_101931464 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300006852|Ga0075433_11014890 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium F42-01 | 723 | Open in IMG/M |
| 3300006852|Ga0075433_11405798 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006904|Ga0075424_100738826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300006904|Ga0075424_100755934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1037 | Open in IMG/M |
| 3300006904|Ga0075424_101397391 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300006914|Ga0075436_100930782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300006969|Ga0075419_10554997 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300007265|Ga0099794_10477810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 655 | Open in IMG/M |
| 3300007788|Ga0099795_10124474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1034 | Open in IMG/M |
| 3300009089|Ga0099828_11027131 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300009089|Ga0099828_12039285 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009094|Ga0111539_11460358 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 793 | Open in IMG/M |
| 3300009100|Ga0075418_11397568 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300009137|Ga0066709_102495835 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300009137|Ga0066709_104690850 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009147|Ga0114129_12461893 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300009156|Ga0111538_11793979 | Not Available | 772 | Open in IMG/M |
| 3300009156|Ga0111538_13307548 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009162|Ga0075423_11590994 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300009162|Ga0075423_13156073 | Not Available | 505 | Open in IMG/M |
| 3300009174|Ga0105241_11654271 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300009177|Ga0105248_10976101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 957 | Open in IMG/M |
| 3300009177|Ga0105248_11961503 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009700|Ga0116217_10253928 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300010046|Ga0126384_10652029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 928 | Open in IMG/M |
| 3300010048|Ga0126373_12988584 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010336|Ga0134071_10172901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300010336|Ga0134071_10444494 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300010360|Ga0126372_12775538 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010362|Ga0126377_13563825 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300010366|Ga0126379_10875940 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300010398|Ga0126383_10829165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1009 | Open in IMG/M |
| 3300010398|Ga0126383_12040678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300010400|Ga0134122_11450948 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300010403|Ga0134123_10787966 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300010854|Ga0126360_1118619 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010862|Ga0126348_1228688 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300010864|Ga0126357_1287302 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010867|Ga0126347_1498875 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012079|Ga0153918_1069262 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012189|Ga0137388_11534745 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium F42-01 | 603 | Open in IMG/M |
| 3300012199|Ga0137383_10159732 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300012200|Ga0137382_10023191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 3599 | Open in IMG/M |
| 3300012200|Ga0137382_10028115 | All Organisms → cellular organisms → Bacteria | 3324 | Open in IMG/M |
| 3300012202|Ga0137363_10602828 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300012203|Ga0137399_10109466 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300012206|Ga0137380_10154819 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
| 3300012206|Ga0137380_11051895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300012208|Ga0137376_10611750 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300012209|Ga0137379_11227756 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012354|Ga0137366_10573575 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012357|Ga0137384_10798510 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300012359|Ga0137385_11599837 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012532|Ga0137373_10262969 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300012925|Ga0137419_11945574 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012958|Ga0164299_11563694 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012971|Ga0126369_13096267 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012984|Ga0164309_11554302 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012985|Ga0164308_11386146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300012989|Ga0164305_10797065 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300013105|Ga0157369_12131792 | Not Available | 568 | Open in IMG/M |
| 3300013296|Ga0157374_10069039 | All Organisms → cellular organisms → Bacteria | 3327 | Open in IMG/M |
| 3300014493|Ga0182016_10279125 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300015373|Ga0132257_103812373 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300015374|Ga0132255_103686758 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300016270|Ga0182036_10757557 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300016319|Ga0182033_10209299 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300016319|Ga0182033_10408487 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300016319|Ga0182033_10962936 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300016341|Ga0182035_10037495 | All Organisms → cellular organisms → Bacteria | 3192 | Open in IMG/M |
| 3300016341|Ga0182035_11780706 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
| 3300016357|Ga0182032_11542091 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300016371|Ga0182034_10281533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1325 | Open in IMG/M |
| 3300016387|Ga0182040_10282326 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300016404|Ga0182037_10005388 | All Organisms → cellular organisms → Bacteria | 7065 | Open in IMG/M |
| 3300016404|Ga0182037_11396092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300016404|Ga0182037_11604975 | Not Available | 578 | Open in IMG/M |
| 3300016422|Ga0182039_10950522 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 769 | Open in IMG/M |
| 3300016422|Ga0182039_10959739 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 765 | Open in IMG/M |
| 3300016422|Ga0182039_11202381 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 685 | Open in IMG/M |
| 3300016445|Ga0182038_12118725 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300017933|Ga0187801_10138890 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300018022|Ga0187864_10212538 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300018046|Ga0187851_10493663 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300018047|Ga0187859_10428707 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300018431|Ga0066655_11213216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp2 | 535 | Open in IMG/M |
| 3300020199|Ga0179592_10267068 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300020579|Ga0210407_10480220 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300020579|Ga0210407_11197364 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300020580|Ga0210403_11437304 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300020583|Ga0210401_10908844 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium F42-01 | 739 | Open in IMG/M |
| 3300020583|Ga0210401_11005803 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300021168|Ga0210406_10457826 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300021178|Ga0210408_11138222 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300021404|Ga0210389_10011635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 6777 | Open in IMG/M |
| 3300021404|Ga0210389_11448108 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300021405|Ga0210387_10982081 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300021432|Ga0210384_10946209 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300021560|Ga0126371_11096835 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300022531|Ga0242660_1199205 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300025905|Ga0207685_10781709 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300025908|Ga0207643_10415177 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 852 | Open in IMG/M |
| 3300025909|Ga0207705_10633364 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300025929|Ga0207664_11831337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300025934|Ga0207686_11078637 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300025960|Ga0207651_10165132 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300025961|Ga0207712_11971976 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300026023|Ga0207677_11783599 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 571 | Open in IMG/M |
| 3300026095|Ga0207676_12267422 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300026116|Ga0207674_11685126 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300026142|Ga0207698_10412189 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300026295|Ga0209234_1144448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 850 | Open in IMG/M |
| 3300026319|Ga0209647_1003150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12924 | Open in IMG/M |
| 3300026320|Ga0209131_1095131 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300026358|Ga0257166_1038666 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300026369|Ga0257152_1031943 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026377|Ga0257171_1067001 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300026446|Ga0257178_1055958 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026482|Ga0257172_1111046 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026497|Ga0257164_1042267 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300026551|Ga0209648_10363591 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300026555|Ga0179593_1007532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 4174 | Open in IMG/M |
| 3300026557|Ga0179587_10001680 | All Organisms → cellular organisms → Bacteria | 10238 | Open in IMG/M |
| 3300026557|Ga0179587_11086205 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027108|Ga0207946_102377 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300027371|Ga0209418_1023612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
| 3300027548|Ga0209523_1076799 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300027703|Ga0207862_1149772 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300027765|Ga0209073_10081666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300027783|Ga0209448_10062401 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300027884|Ga0209275_10084174 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300028792|Ga0307504_10067141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300029636|Ga0222749_10054816 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300031090|Ga0265760_10250070 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031231|Ga0170824_124668397 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300031474|Ga0170818_103354837 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300031545|Ga0318541_10591249 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031572|Ga0318515_10736994 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031640|Ga0318555_10244542 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300031668|Ga0318542_10228558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 943 | Open in IMG/M |
| 3300031680|Ga0318574_10837635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 539 | Open in IMG/M |
| 3300031718|Ga0307474_11160541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300031719|Ga0306917_10312805 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300031720|Ga0307469_10778500 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300031720|Ga0307469_11466313 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031744|Ga0306918_10394936 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300031753|Ga0307477_10279582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300031753|Ga0307477_10752770 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031754|Ga0307475_10065735 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| 3300031754|Ga0307475_10642012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300031754|Ga0307475_10807668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300031754|Ga0307475_10992108 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031754|Ga0307475_11063920 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031754|Ga0307475_11576972 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031771|Ga0318546_10954828 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031780|Ga0318508_1226418 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031819|Ga0318568_10127430 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300031819|Ga0318568_10231510 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300031820|Ga0307473_11540295 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300031821|Ga0318567_10316730 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300031823|Ga0307478_11397173 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031823|Ga0307478_11485716 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031833|Ga0310917_10017416 | All Organisms → cellular organisms → Bacteria | 4073 | Open in IMG/M |
| 3300031835|Ga0318517_10180773 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300031845|Ga0318511_10418596 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031859|Ga0318527_10356754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp2 | 623 | Open in IMG/M |
| 3300031879|Ga0306919_11337559 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 542 | Open in IMG/M |
| 3300031890|Ga0306925_10222475 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300031890|Ga0306925_10473417 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300031910|Ga0306923_10134150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2818 | Open in IMG/M |
| 3300031946|Ga0310910_11147011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 604 | Open in IMG/M |
| 3300031954|Ga0306926_10172051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2686 | Open in IMG/M |
| 3300031954|Ga0306926_12652433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 545 | Open in IMG/M |
| 3300031962|Ga0307479_10336073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 1493 | Open in IMG/M |
| 3300031962|Ga0307479_10474286 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300031962|Ga0307479_11043198 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300031962|Ga0307479_11352124 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300032025|Ga0318507_10328091 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300032052|Ga0318506_10008421 | Not Available | 3327 | Open in IMG/M |
| 3300032054|Ga0318570_10480110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 567 | Open in IMG/M |
| 3300032060|Ga0318505_10483731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 584 | Open in IMG/M |
| 3300032089|Ga0318525_10601975 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
| 3300032091|Ga0318577_10146826 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300032091|Ga0318577_10355004 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300032094|Ga0318540_10299251 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300032174|Ga0307470_10805812 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300032180|Ga0307471_101338496 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300032180|Ga0307471_102351371 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300032180|Ga0307471_102445614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300032205|Ga0307472_100245806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1399 | Open in IMG/M |
| 3300032205|Ga0307472_101946257 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300032261|Ga0306920_103087044 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300032261|Ga0306920_103385763 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300032261|Ga0306920_104026167 | Not Available | 533 | Open in IMG/M |
| 3300033289|Ga0310914_10348032 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300033289|Ga0310914_10635485 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.42% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.42% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012079 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL002 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027108 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_03136600 | 2124908009 | Soil | MVSIAVVTRADLLIARRASIWTVEEHLSGLSPQCVAVDLRSPAQLYCGTARDGLFRSRDSGR |
| JGI1027J12803_1001862302 | 3300000955 | Soil | MVGIVVVTHAALLIARRISTRTIDPHLGGLSPECVAVDLRS |
| JGI1027J12803_1009601504 | 3300000955 | Soil | MVGIVVVTQAGLLIARHASTWTIDEHLGGRSPECVAVDLRGPTQVYCGTARAGLFRSRD |
| JGI1027J12803_1024874982 | 3300000955 | Soil | MVSIVVVTQAALWIARRASTWTVDEHLGGRSPDCVAVDPRDPT |
| JGI1027J12803_1083555453 | 3300000955 | Soil | MVGIVVVTRASLLIARRTLTWTIDAHLGGLSPECVAVDLRS |
| JGI12627J18819_100708542 | 3300001867 | Forest Soil | MVGIVVVTRAAVLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARAGLFRSRD |
| JGI25384J37096_101350851 | 3300002561 | Grasslands Soil | MVGIIVVTRAALLIARRTSTWTIDAHLGGLSPECVAVDLRSPAKLYCGTARDGLFRSRDS |
| C688J35102_1182947051 | 3300002568 | Soil | MEIEMDNVGIVVVTRAALLLARRASTWTVDEHLGGRSPVSVAVDL |
| Ga0066680_106061952 | 3300005174 | Soil | MVGIVVVRRAALLIARRTSTWTIDAHLGGRSPECVAVDLRSPAQVYCGTAR |
| Ga0066679_102142341 | 3300005176 | Soil | MVGIIVVTRAALLIARRTSTWTIDAHLGGLSPECVAVDLRSPA |
| Ga0066688_101740824 | 3300005178 | Soil | MVGIIVVTRAALLIARRTSTWTIDAHLGGLSPECVAVDLRSPAKLYCGTARDGLFRSR |
| Ga0066684_100101341 | 3300005179 | Soil | MVGIVVVTRAALLIARRASSWMIDKHLDGLSPECVAVDLGSP |
| Ga0065715_104737171 | 3300005293 | Miscanthus Rhizosphere | MVGIAVVTEAGLLIARRASTWTVDERLGGRSPECVAVDLRRPTQVYCGTARAGLL |
| Ga0066388_1066944221 | 3300005332 | Tropical Forest Soil | MVGITVVTRAALLIARHASTWTVDEHLGGRSPDCVAVDPRDPTRVYCGTAG |
| Ga0070669_1017545491 | 3300005353 | Switchgrass Rhizosphere | MVGIAVVTQAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGT |
| Ga0070675_1014715672 | 3300005354 | Miscanthus Rhizosphere | MVCIVVVTRVALLIARRASPSTWTVDEHLGGRSPKCVAADLRDPAQVYCGTRWCR |
| Ga0070671_1001096814 | 3300005355 | Switchgrass Rhizosphere | MVGLVIVTQAALLIARRASTWTVDKYLGGRSPDCIAVDPRDPTRLYCG |
| Ga0070709_109278762 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGIVVVTQAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCG |
| Ga0070705_1012499361 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGIVVVTRAALLIARRASTWTIDEHLGGLSPECVAVDLRGPTQVYCGTAR |
| Ga0070707_1015573081 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGIVVVTRAALLIARRASAWTIDEYLGGLSPECVAVDLR |
| Ga0073909_104491931 | 3300005526 | Surface Soil | MKMVGIAVVTEAGLLIARRASTWTVDERLGGRSPECVAVDLRRPAQVYCGTARAGLLRSRDSGRNWEPVGP |
| Ga0066697_101346291 | 3300005540 | Soil | MVGIIVVTRAAVLIARRTSTWTIDAHLGGLSPECVAVDLRSPAKLYCGTAR |
| Ga0066697_107838181 | 3300005540 | Soil | MVGIIVVTRAALLIARRTSTWTIDAHLGGLSPECVAVDLRSPAKLYCGTAR |
| Ga0070732_108119181 | 3300005542 | Surface Soil | MFGIVVVTRASLLIARRASTWTVDEHLAGLSPGCVAVDLSS |
| Ga0070695_1007086093 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLS |
| Ga0070696_1017477282 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGIVVVAPAALLIARRASTWTIDEHLGGLSPECVAVDLRGPTQVYCG |
| Ga0070693_1009630071 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSIIVVTRAALLIARGSAWAVEEHLRARGADCVAVDAGDPTRVY |
| Ga0070704_1008979852 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRIVVVTRAALLIARPASTSTWTVDEHLGGRSPKCVAVDPRDPAQVYCGTAGAGLFR |
| Ga0066708_110167022 | 3300005576 | Soil | VVGIVVVTRAALLIARRAATWTVEEHLGGRSPQCVAVDPSRPAQVY |
| Ga0066654_102894221 | 3300005587 | Soil | MVGGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARAG |
| Ga0066903_1006336974 | 3300005764 | Tropical Forest Soil | MVSLVVVTRAALLIARRANTWTIEEHLRGESSECVAVDSRRAARLYCG |
| Ga0068863_1025080631 | 3300005841 | Switchgrass Rhizosphere | MVSIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTAR |
| Ga0075024_1003348342 | 3300006047 | Watersheds | MVGIVVVTQAALLIARRASTWTVDEHLADCLPDVAVDLSSPAQV |
| Ga0075028_1002204092 | 3300006050 | Watersheds | MISIVVVTRAALWIARRASTWTVDEHLGGRSPDCVAVDPRDPTRVYCGT |
| Ga0075029_1008817382 | 3300006052 | Watersheds | MVGIVVVTQAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYC |
| Ga0070716_1014103771 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGIVVVTRAAVLIARRASTWTIDEHLAGLSPGCVA |
| Ga0075021_104490291 | 3300006354 | Watersheds | MVGIVVVTRASLLIARRTSTWTIDEHLSGRSPECVAVDLRRPTQVY |
| Ga0079222_106486541 | 3300006755 | Agricultural Soil | MVGIVVVTQAALLIARRASTWTIDVHLGGLSPACVAVDPRS |
| Ga0075428_1005948791 | 3300006844 | Populus Rhizosphere | MVGIIVVTRAALLIARRASTWTIDEHLGGRSPQCVAVDLSGPAQVYCGTARAG |
| Ga0075428_1019314641 | 3300006844 | Populus Rhizosphere | MVGIVVVTRAALLIARRASTWTVEEHLGGQSPECVAVDLRGPA |
| Ga0075433_110148902 | 3300006852 | Populus Rhizosphere | MVGIVVVTRAALLIARRTSTWTIDAHLGGLSPACVAV |
| Ga0075433_114057983 | 3300006852 | Populus Rhizosphere | MVGFVVVTRAALLIARRASTWTIDEHLGGQSPECVAVDLRGPAQVYCGTARAGLFRSRDS |
| Ga0075424_1007388261 | 3300006904 | Populus Rhizosphere | MVGIVVVTRAALLIARRASTWMVDEHLAGLSPGCVAVDLSSPA |
| Ga0075424_1007559343 | 3300006904 | Populus Rhizosphere | MVSIVVVTRATLLIARRASTWTVDEHLGGRSPECVAVD |
| Ga0075424_1013973912 | 3300006904 | Populus Rhizosphere | MVGIVVVTRASLLIARRTSTWTIDEHLGGLSPECVAVDLRSPAQVYC |
| Ga0075436_1009307821 | 3300006914 | Populus Rhizosphere | MVGIVVVTRAALLIARRAYTWTIDAHLGGLSPECVAVDLRSPTQVYCGTARAGLFRSRDSGRN |
| Ga0075419_105549971 | 3300006969 | Populus Rhizosphere | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLSSP |
| Ga0099794_104778103 | 3300007265 | Vadose Zone Soil | MVGIVVVTQAALLIARRASTWTVDEHLAGLSPGCVAVDLSS |
| Ga0099795_101244741 | 3300007788 | Vadose Zone Soil | MKMIGIAVVTEAGLLIARRASTWAVAERLGGRSPECVAVDL |
| Ga0099828_110271311 | 3300009089 | Vadose Zone Soil | MVGIVVVTRAALLIARPASTWTVAEHLNGRSPVCVAV |
| Ga0099828_120392852 | 3300009089 | Vadose Zone Soil | MVSIVIATRAALLIARPASTWTVAEHLNGRSPVCVAV |
| Ga0111539_114603581 | 3300009094 | Populus Rhizosphere | MVGIVVVTRAGLLIARRASTWIIDDHLGGRSPECIAVDLRDALG* |
| Ga0075418_113975682 | 3300009100 | Populus Rhizosphere | MVGIIVVTRAALLIARRASTWTIDEHLGGRSPECVAVDLRGPAQVYCGTAR |
| Ga0066709_1024958351 | 3300009137 | Grasslands Soil | MVDIVVVTRAGLLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTAR |
| Ga0066709_1046908502 | 3300009137 | Grasslands Soil | MVGIIVVTRAALLIARRASTWTIDEHLGGRSPECVALD |
| Ga0114129_124618931 | 3300009147 | Populus Rhizosphere | MVGIAVVTRAALLIARPASTWTVAEHLNGRTPVCVAVDARDPTRVYC |
| Ga0111538_117939791 | 3300009156 | Populus Rhizosphere | MNLVVVTRSALLIARHGSKWVVDERLPGRSPLCVAVDPRDAARVYCG |
| Ga0111538_133075481 | 3300009156 | Populus Rhizosphere | MVGIVVVTRAALLIARRASTWTVEEHLGGQSPECVAVDLRGPAQVYCGTARAGLFRSRD |
| Ga0075423_115909942 | 3300009162 | Populus Rhizosphere | MDNIIVVTRVAVLIARRSSKWTVEEHLGGRSPECVAVDP |
| Ga0075423_131560731 | 3300009162 | Populus Rhizosphere | MVGIVVVTRAALLIARRAATWTVEEQLGGRSPACVALD |
| Ga0105241_116542712 | 3300009174 | Corn Rhizosphere | MVGIVVVTRAALLIARRASTWTIDVHLGGLSPGCVAVD |
| Ga0105248_109761012 | 3300009177 | Switchgrass Rhizosphere | MVGIVVVTQAALLIARRASTWTVDEHLAGLSPGCVAVDLSSP |
| Ga0105248_119615031 | 3300009177 | Switchgrass Rhizosphere | MVGIVVVTRAALLIARRASTWTIDEYLSGRSPECVAVDLRRPTQVYCGTAGDGLFRS |
| Ga0116217_102539281 | 3300009700 | Peatlands Soil | MVGIVVVTRAALLIARPASTWTVAEHLNGRSPVCVAVDT |
| Ga0126384_106520291 | 3300010046 | Tropical Forest Soil | MVGLVVVTRAALLIARRASTWTIEEHLGGRSPGCVAVDLHAPAQMYCGT |
| Ga0126373_129885841 | 3300010048 | Tropical Forest Soil | MVGIVVVTRAGLLIARRASTWTIDEHLGGRSPGCVAVNLHAPAQVYCGTARAGLFR |
| Ga0134071_101729011 | 3300010336 | Grasslands Soil | MVGIVVVTRAALLIARRASTWTIDEHLGGLSPECVAVDLRGPAQVYCGTARAGLF |
| Ga0134071_104444941 | 3300010336 | Grasslands Soil | MVGIIVVTRAALLIARRTSTWTIDAHLGGLSPECVAVDLRSPAELYCGTAR |
| Ga0126372_127755381 | 3300010360 | Tropical Forest Soil | MVGIVVVTRAALLIARRASTWTVEEHLGGRSPECVAVDLRRPAQVYCGTAR |
| Ga0126377_135638251 | 3300010362 | Tropical Forest Soil | MISIVVVTQAALWIARRASIWTVDEHLGGRSPDCVA |
| Ga0126379_108759403 | 3300010366 | Tropical Forest Soil | LVGIAVVTRAALFIARRASAWTVDEHLGGRSPDCVAVDPRDPTRVYCGT |
| Ga0126383_108291653 | 3300010398 | Tropical Forest Soil | MVGLVVVTRAALLIARRASTWSIDEHLGGRSPGCVAVDLHAPAQMYCGTAR |
| Ga0126383_120406781 | 3300010398 | Tropical Forest Soil | MVSVVVVTRAALLIARRATTWTIEEHLRGESSECVAVDSRRAARLYCGTARGLFRSDDG |
| Ga0134122_114509482 | 3300010400 | Terrestrial Soil | MVGIVVVTRAALLIARRASTRTIDVHLGGLSPACVAVDQRSPA |
| Ga0134123_107879661 | 3300010403 | Terrestrial Soil | MVRIVVVTRAALLIARPASTSTWTVDEHLGGRSPKCV |
| Ga0126360_11186191 | 3300010854 | Boreal Forest Soil | MVGIVVVTRAALLIARPASIWTVGEHLNGRSPVCVAVDTRDPTRVYCGTAD |
| Ga0126348_12286882 | 3300010862 | Boreal Forest Soil | MVGIVVVTRAALLIARPASTWTVAEHLNGRSPVCVAVDTRD |
| Ga0126357_12873021 | 3300010864 | Boreal Forest Soil | VVGIVVVTRAALLIAQRASTWTVEEHLGGRSPKCVAVDPSGPTEVYCGTARAG |
| Ga0126347_14988751 | 3300010867 | Boreal Forest Soil | MVGIAVGTRAARLIARPASAWTVAEHLNGRSPACVAVDTRDPTR |
| Ga0153918_10692621 | 3300012079 | Attine Ant Fungus Gardens | MVGILVVTQAALLIARRASTWTIDVHLGGLSPACVAVDQRSPAQVTAELRVTGLFRSRDGGRNWEPT |
| Ga0137388_115347452 | 3300012189 | Vadose Zone Soil | MVGIVVVTRAALLIARRTSTWTIDAHLGGLSPECVA |
| Ga0137383_101597322 | 3300012199 | Vadose Zone Soil | MVGIVVVTQAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARAGLFRSR |
| Ga0137382_100231917 | 3300012200 | Vadose Zone Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVD |
| Ga0137382_100281151 | 3300012200 | Vadose Zone Soil | MVGIVVVTRAALLIARRASTWTVGEHLAGLSPGCVAVDLSSPAQVYCGTAR |
| Ga0137363_106028281 | 3300012202 | Vadose Zone Soil | MVGIVVATRAALLIARPASTWNIAEHLHGRSPVSVAVDTRDPTRVYC |
| Ga0137399_101094661 | 3300012203 | Vadose Zone Soil | MVGIIVVTRAALLIARRTSTWTIDAHLGGLSPECVAVDLSQSG* |
| Ga0137380_101548191 | 3300012206 | Vadose Zone Soil | MVGIIVVTRAALLIARRTSTWTIDAHLGGLSPECVAVDLRSPAKLYCG |
| Ga0137380_110518951 | 3300012206 | Vadose Zone Soil | MVGIVVVTQAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTA |
| Ga0137376_106117501 | 3300012208 | Vadose Zone Soil | VVGIVVVTRAALLIARRASTWTVEEHLGGRSPTCVAVDPSGPARVYCGT |
| Ga0137379_112277562 | 3300012209 | Vadose Zone Soil | MVGIVVVTRAAVLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVY |
| Ga0137366_105735752 | 3300012354 | Vadose Zone Soil | MVGIVVVTRAALLIARRASTWAIDVHLGGQSPQCVAVDQ |
| Ga0137384_107985102 | 3300012357 | Vadose Zone Soil | MVGIVVVTRAALLIARPVSTWTVAEHLNGRSPVCVAV |
| Ga0137385_115998372 | 3300012359 | Vadose Zone Soil | MVGIAVVTRAALLIARPASTWTVVEHLNGRSPVCVAV |
| Ga0137373_102629694 | 3300012532 | Vadose Zone Soil | MVGIVVVTRAALLIARHASTWTVDEHLGGRSPDCVAVD |
| Ga0137419_119455741 | 3300012925 | Vadose Zone Soil | MVSIVVVTRAALLIARRTSTWTIDAHLGGLSPECVAVDLRSPAQVYC |
| Ga0164299_115636942 | 3300012958 | Soil | VVGIVVVTRAALLIARRASTCTVEEHLGGRSPQCVAVDPSRPARVYCGTARAGLFRS |
| Ga0126369_130962671 | 3300012971 | Tropical Forest Soil | MVSIVVVTEAALLIARRASTWTVAEHLGGRSPDCVAVDPRDPTRVYCGTAGA |
| Ga0164309_115543021 | 3300012984 | Soil | MVGIVVVTRAALLIARRASTWTIDEHLSGQSPECVAVDLRRPTQVYCGTA |
| Ga0164308_113861462 | 3300012985 | Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPA |
| Ga0164305_107970651 | 3300012989 | Soil | MVGIVVVTRAALLIARRASTWTVAEHLNGRSPVCVAVDTRDPTSVYCGTAGAGLLRSRDSGRHWEPVGPG |
| Ga0157369_121317922 | 3300013105 | Corn Rhizosphere | MVNLIVVTRAALLIARRGSSWTVEEHLRGLSPDCIAVDLHDPTRAYCG |
| Ga0157374_100690396 | 3300013296 | Miscanthus Rhizosphere | MVGLVIVTQAALLIARRASTWTVDKYLGGRSPDCIAVDPRGPTRLYCGTAGAGLFRS |
| Ga0182016_102791251 | 3300014493 | Bog | MAGIVVVTRAALLIARRASTWTIEEHLAGRSPQCVAADLRG |
| Ga0132257_1038123731 | 3300015373 | Arabidopsis Rhizosphere | MVGIVVVTRAALLIARRTTTWTIDEHLGGLSPACVAVDQCSPAHVYCGTAR |
| Ga0132255_1036867581 | 3300015374 | Arabidopsis Rhizosphere | VVGIVVVTRAALLIARRAATWTVEEHLGGRSPQCVAVDPSRPAQV |
| Ga0182036_107575573 | 3300016270 | Soil | MVGIVVVTRAGLLIARRASTWTIDEHLGGRSPTSV |
| Ga0182033_102092991 | 3300016319 | Soil | MVGILVVTRAALLIARRASPWTVEEHLAGRSPVCVAVDPKVLKRALDAVQ |
| Ga0182033_104084874 | 3300016319 | Soil | MVGIVVVTRAGLLIARRASTWTIDEHLGGRSPTSVAVDPRRPAQVYCG |
| Ga0182033_109629362 | 3300016319 | Soil | LVGIVVVTRAALFIARRASTWTVDEHLGGRSPDCAAVDPRD |
| Ga0182035_100374956 | 3300016341 | Soil | MVSIVVVTQAALLIARRASTWSVEEHLGGRSLDCVAVDPRD |
| Ga0182035_117807061 | 3300016341 | Soil | MIRIVVVTRAALWIARRASTWTVDEHLGGRSPDCVAVDPRDPTRVYCGTAGAGL |
| Ga0182032_115420911 | 3300016357 | Soil | MIRIVVVTRAALWIARRASTWTVDEHLGGRSPDCVAVDPRDPTRVYCGTASGGL |
| Ga0182034_102815331 | 3300016371 | Soil | MVGLVVVTRAALLIARRASTWSIDEHLGGRSPGCVAVDLHAPAQMYCGT |
| Ga0182040_102823262 | 3300016387 | Soil | MVSIVVITRAALLIARRASTWTVDEHLAGRSPDCVAVDSRDPTRVYCG |
| Ga0182037_100053881 | 3300016404 | Soil | MVAIVVVTRAALLIARRASTWAIDEHLGGRSPECVAWP |
| Ga0182037_113960921 | 3300016404 | Soil | MGGITVVTRAALLIARHASTWTVDEHLGGRSPDCVA |
| Ga0182037_116049751 | 3300016404 | Soil | MIGIVVVTRAALLIARRASTWTIDEHLGGLSPECVTV |
| Ga0182039_109505221 | 3300016422 | Soil | MVGIVVVTRAALLIARPASTWTVAEHLNGRSPVCLAVDTR |
| Ga0182039_109597391 | 3300016422 | Soil | MIRIVVVTRAALWIARRASTWTVDEHLGGRSPDCVAVDPR |
| Ga0182039_112023812 | 3300016422 | Soil | MVGIVVVTRAALLIARRASTWTVDEHLGGRSPDCVAVDPRDP |
| Ga0182038_121187251 | 3300016445 | Soil | MVSITIVTRAALLIARRASTWTVDEHLGGRSPDCVAV |
| Ga0187801_101388901 | 3300017933 | Freshwater Sediment | MVGIVVVTRAAVLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGT |
| Ga0187864_102125382 | 3300018022 | Peatland | MVGIAVVTRAALLIARRASTWTIEEHLAGRSPECV |
| Ga0187851_104936631 | 3300018046 | Peatland | MVGIAVVTRAALLIARRASTWTIEEHLAGRSPECVAVDLRGPTQVYCGTAS |
| Ga0187859_104287071 | 3300018047 | Peatland | MFSIVVVTRAALLIARRASTWTIDEHLGGQSPQCVAVDQRSPAQVYCGTA |
| Ga0066655_112132163 | 3300018431 | Grasslands Soil | MVGIVVVTRAALLIARRASTWTIDEHLGGLSPECVAVDLRGPTQVY |
| Ga0179592_102670681 | 3300020199 | Vadose Zone Soil | MVGIAVVTRAALLIARRASAWTIDEHLGGLSPECVAVDPRSTAEVYCGTAR |
| Ga0210407_104802201 | 3300020579 | Soil | MAGIAVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARAGLFRSRDS |
| Ga0210407_111973642 | 3300020579 | Soil | MVGIVVVTRAALLIARHASTWTIDEHLGGLSPECVAVDLRSPAQVYCGTARDGLFRSR |
| Ga0210403_114373042 | 3300020580 | Soil | MAGVVVVTGAALLIARGVSTWTIDEHLGGRLPECVAVDPR |
| Ga0210401_109088442 | 3300020583 | Soil | MVSIVVVTRAALLIARRASTWTVEEHLCGLSPQCVAVDLRSPAQMYCGTARAGLFR |
| Ga0210401_110058031 | 3300020583 | Soil | MVGIAVVTRAALLIARRASTWTIEEHLDGRSPECVAVDLRG |
| Ga0210406_104578261 | 3300021168 | Soil | MAGIVVVTRAALLIARRASTWTIDEYLGGRSPQCVAVDLRRPTQVY |
| Ga0210408_111382222 | 3300021178 | Soil | MVGIVVVTRAALLIARRASTWTVDEHLGGLSPECVAVD |
| Ga0210389_100116351 | 3300021404 | Soil | VVSIAVVTRAALLIARRASTWTVDEHLAGLSPESVAVDLRNSAHVYCGTARAG |
| Ga0210389_114481082 | 3300021404 | Soil | MVGIVVVTRAAVLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARAGLFRSRDS |
| Ga0210387_109820811 | 3300021405 | Soil | MVGIIVVTRAAVLIARYASTWTVDEHLAGLSPGCVAVDLSSPTQVYCGT |
| Ga0210384_109462091 | 3300021432 | Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLTS |
| Ga0126371_110968351 | 3300021560 | Tropical Forest Soil | MVGIAVVTRAALLIARRASTWTVEEHLGGRSPGCVAVDLRSPAQLYCGTTGAGLF |
| Ga0242660_11992052 | 3300022531 | Soil | MVGIVVVTRAAVLIARRASTWTVDEYLAGLSPGCVAVDLSSPAQVYCG |
| Ga0207685_107817091 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLNSPAQVYCGTARAGLFRSR |
| Ga0207643_104151772 | 3300025908 | Miscanthus Rhizosphere | MKIVGIAVVTEAGLLIARRASTWTVDERLGGRSPECVAVDLRRPAQVYCGTARTGLLRSR |
| Ga0207705_106333643 | 3300025909 | Corn Rhizosphere | MVNLIVVTRAALLIARRGSSWTVEEHLRGLSPDCIAVDLHDPTRAYCGTAHGGL |
| Ga0207664_118313372 | 3300025929 | Agricultural Soil | MVGIAVVTRAALLIARRASTWTIDEHLCGSSPQCVAVDLRNPAQMYC |
| Ga0207686_110786371 | 3300025934 | Miscanthus Rhizosphere | MVRIVVVTRAALLIARPASTSTWTVDEHLAGRSPECLAVDPR |
| Ga0207651_101651321 | 3300025960 | Switchgrass Rhizosphere | MVGIVVVTRAALLIARRASTRTIDVHLGGLSPGCVAV |
| Ga0207712_119719762 | 3300025961 | Switchgrass Rhizosphere | MVRIVVVTRAALLIARRASTSTWTVDEHLGGRSPECLAVDPRDPA |
| Ga0207677_117835991 | 3300026023 | Miscanthus Rhizosphere | MVTIAVVTEAGLLIARRASTWSVDERLGGRAPECVAVDLRRPAQVYCGTTR |
| Ga0207676_122674221 | 3300026095 | Switchgrass Rhizosphere | MVTIAVVTEAGLLIARRASTWSVDERLGGRAPECVAVDPRRPAQVYCGTARAGLLR |
| Ga0207674_116851263 | 3300026116 | Corn Rhizosphere | MVNLIVVTRAALLIARRGSSWTVEEHLRGLSPDCIAVDLHDPTRAYC |
| Ga0207698_104121892 | 3300026142 | Corn Rhizosphere | MVGIVVVTRAALLIARRASTRTIDVHLGGLSPGCVAVDQRSPAQVYCGTARDGLFRSRD |
| Ga0209234_11444483 | 3300026295 | Grasslands Soil | MVGIVVVTRAAVLIARRASTWTVDEHLAGLSPGCVAVDLSSPA |
| Ga0209647_10031501 | 3300026319 | Grasslands Soil | MVGIVVVTRAALLTARRASTWTIDEHLGGRSPECV |
| Ga0209131_10951314 | 3300026320 | Grasslands Soil | MVGIAVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARAGLFRSRDS |
| Ga0257166_10386662 | 3300026358 | Soil | MVGIIVVTRAALLIARRTSTWTIDAHLGGLSPECV |
| Ga0257152_10319432 | 3300026369 | Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLNSPAQVYCG |
| Ga0257171_10670011 | 3300026377 | Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARA |
| Ga0257178_10559582 | 3300026446 | Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLNSPAQVYCGTAR |
| Ga0257172_11110461 | 3300026482 | Soil | MVGIIVVTRAALLIARRTSTWTIDAHLGGLSPECVAVDL |
| Ga0257164_10422672 | 3300026497 | Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDL |
| Ga0209648_103635911 | 3300026551 | Grasslands Soil | MVGIAVVTRAALLIARRASAWTVDEHMRGRSPECV |
| Ga0179593_10075327 | 3300026555 | Vadose Zone Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAV |
| Ga0179587_100016801 | 3300026557 | Vadose Zone Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLNNPAQVYC |
| Ga0179587_110862051 | 3300026557 | Vadose Zone Soil | VVGIVVVTRAALLIARRAATWTVEEHLGGRSPQCVAVD |
| Ga0207946_1023772 | 3300027108 | Forest Soil | MVGIVVVTRAAVLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARAGL |
| Ga0209418_10236122 | 3300027371 | Forest Soil | MVGIVVVTRAAVLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARDGLFRSRDG |
| Ga0209523_10767991 | 3300027548 | Forest Soil | MVGIVVVTRAALLIARRASTWTMEEHLGGRSPECVAVDLRGPTQVYC |
| Ga0207862_11497721 | 3300027703 | Tropical Forest Soil | MVGIVVVTRAALLIARRASTWTIDEHLGGRSPECVAVDLRGSA |
| Ga0209073_100816662 | 3300027765 | Agricultural Soil | MVGIAVVTPAALLIARRASTWTIDEHLGGRSPECVAADLRSSAQVYCGTARDGLFRS |
| Ga0209448_100624011 | 3300027783 | Bog Forest Soil | MVGIVVVTRAALLIARRASTWTIDEHLGGRSPQCVAVDLRDP |
| Ga0209275_100841743 | 3300027884 | Soil | MVGIAVVTRAALLIARRASTWTVDEHLAGLSPGCVAIDQSSPA |
| Ga0307504_100671411 | 3300028792 | Soil | MTAPSRIVVVTRAALLIARRASTWTIDEHLGGLSPE |
| Ga0222749_100548165 | 3300029636 | Soil | MVGIVVVTRASLLIARRTSSWTIDAHLGGLSPESVAVDLRSPAQVYCGTARDGLFRSSDNGRNW |
| Ga0265760_102500702 | 3300031090 | Soil | MVGIAVVTRAALLIARRASTWTVDEHLAGLSPGCVAIDLSSPA |
| Ga0170824_1246683973 | 3300031231 | Forest Soil | MVSIVVVTRAALLIARHASTWTVEEHLGGLSPQCVAVDL |
| Ga0170818_1033548371 | 3300031474 | Forest Soil | MVGIVVVTRAALLTARRASTWTINAHLGGLSPACVAVDQR |
| Ga0318541_105912492 | 3300031545 | Soil | MVGIVVVTRAGLLIARRASTWTIDEHLGGRSPTSVAVDPRR |
| Ga0318515_107369941 | 3300031572 | Soil | MVGIVVVTRAALLIARPASTWTVAEHLNGRSPVCVAVDTRDPTRVYCG |
| Ga0318555_102445423 | 3300031640 | Soil | MVSITVVTRAALLIARRASTWTVDEHLGGRSPDCVAVDPRDPTRVYCGTA |
| Ga0318542_102285581 | 3300031668 | Soil | MVGIVVVTRAALMIARRASTWTIDEHLGGRSPECVAVDLRNPAQVYC |
| Ga0318574_108376352 | 3300031680 | Soil | MVSITVVTRAALLIARRASTWTVDGHLGGRSPACVAVDLRGPAQVYCGTARAGLFLSHDSGRNWEPV |
| Ga0307474_111605412 | 3300031718 | Hardwood Forest Soil | MVGIAVVTRAALLIARRASTWTIDEHMRGQSPECVA |
| Ga0306917_103128051 | 3300031719 | Soil | MVSITIVTRAALLIARHASTWTVDEHLGGRSPDCVAVDP |
| Ga0307469_107785001 | 3300031720 | Hardwood Forest Soil | MVGIIVVTRTALLIARRASTWTVLEHLGGRSPECVAVDLRFPAQVYCGTAQAG |
| Ga0307469_114663131 | 3300031720 | Hardwood Forest Soil | MVGIVVVTRASLLIARRTSTWTIDAHLGGLSPECVAVDLRSPAQVYCGTARDGLF |
| Ga0306918_103949362 | 3300031744 | Soil | MVSITIVTRAALLIARHASTWTVDEHLGGRSPDCVAVDPRDPTRVY |
| Ga0307477_102795822 | 3300031753 | Hardwood Forest Soil | MVGIVVVTRAALLIARRASTWTIDEHLGGRSPESVAV |
| Ga0307477_107527702 | 3300031753 | Hardwood Forest Soil | MVGIVVVTRAALLIARRASTWTVDEHLAALSPGCVAVDLSSPAQVYCGTAR |
| Ga0307475_100657351 | 3300031754 | Hardwood Forest Soil | MVGIAVVTRAALLIARRASTWTIDEHMRGQSPECVAVD |
| Ga0307475_106420122 | 3300031754 | Hardwood Forest Soil | MVGIVVVTRAALLIARRTSTWTIDAHLGGLSPACVAVDLRSPA |
| Ga0307475_108076682 | 3300031754 | Hardwood Forest Soil | MVGIAVVTRAAVLIARRASTWTVDERLAGLSPGCVAVDLSSPAQVYCGTARAGLLRSRDSGRNWEPVGP |
| Ga0307475_109921082 | 3300031754 | Hardwood Forest Soil | MVGIVVVTRAALLIARRASTWTVDEHLAGLSPGCVAVDLSNPAQVYCGTARAG |
| Ga0307475_110639201 | 3300031754 | Hardwood Forest Soil | MVGMVVVTRAALLITRPASTWTIDKHLGGLSPECVAVDLRSPAQVYCGT |
| Ga0307475_115769721 | 3300031754 | Hardwood Forest Soil | MVGMVVVTRAALLIARRASTWTIDKHLGGLSPECVAVDLRSPAQVYCGTARDGLF |
| Ga0318546_109548281 | 3300031771 | Soil | MIGFIVVTRAALLIARRASTWTVDEHLGGQSPECVAVDLRGPAQVYCGTARAG |
| Ga0318508_12264181 | 3300031780 | Soil | MVGIVVVTRAALLIARRASTWTIDEHLSGPSPQCV |
| Ga0318568_101274304 | 3300031819 | Soil | MVSITVVTRAALLIARRASTWTVDEHLGGRSPDCVAVDPRDPTRVYCG |
| Ga0318568_102315102 | 3300031819 | Soil | MVGIVVVTRAALLIARRASTWTIDEHLGGRSPECVAVDLRSPTQMYCG |
| Ga0307473_115402952 | 3300031820 | Hardwood Forest Soil | MVGIVVVTRSALLIARHASTWTVDKHLSGESPACV |
| Ga0318567_103167301 | 3300031821 | Soil | MGGITVVTRAALLIARHASTWTVDEHLGGRSPDCVAVDPRDPTRVYC |
| Ga0307478_113971731 | 3300031823 | Hardwood Forest Soil | MVGIAVVTRAGLLIARHASAWTVDEHLAGLSPGCVAVDPSSPA |
| Ga0307478_114857162 | 3300031823 | Hardwood Forest Soil | MVGIVVVTRSGLLIARRASTWTVEEHLAGLSPECVAVDLSSPAQIYCGTVHDGLFRS |
| Ga0310917_100174166 | 3300031833 | Soil | MVAIVVVTRAALLIARRASTWTIDEHLGGRSPECVAWP |
| Ga0318517_101807732 | 3300031835 | Soil | MVGVVVVTRAELLIARRASTWTIDEHLGGRSPECVAVDLRSPAQMYCGTARAG |
| Ga0318511_104185961 | 3300031845 | Soil | MVGIVVVTRAALLIARRASTWTVAEHLNGRSPVCVAVDP |
| Ga0318527_103567542 | 3300031859 | Soil | LVGIVVVTRAALFIARRASTWTVDEHLGGRSPDCAAVDPRDPMR |
| Ga0306919_113375592 | 3300031879 | Soil | MIRIVVVTRAALWIARRASTWTVDEHLGGRSPACVAVDLRGPAQVYCGTARAGL |
| Ga0306925_102224754 | 3300031890 | Soil | MAGIVVVTRAALLIARRAATWTIEEHLGGLSPGCIAVDLRSPAQIYCGTARAGLFRSR |
| Ga0306925_104734171 | 3300031890 | Soil | MIRIVVVTRAALWIARRASTWTVDEHLGGRSPDCVAVDPRDPTRVY |
| Ga0306923_101341501 | 3300031910 | Soil | MVGIVVVTRAALMIARRASTWTIDEHLGGRSPECVAVDLRSPAQMYCGTARAGLFR |
| Ga0310910_111470111 | 3300031946 | Soil | MIRIVVVTRAALWIARRASTWTVDEHLGGRSPDCVAV |
| Ga0306926_101720515 | 3300031954 | Soil | MVGIVVVTRAALMIARRASTWTIDEHLGGRSPECVA |
| Ga0306926_126524331 | 3300031954 | Soil | MVSIVVITRAALLIARRASTWTVDEHLGGRSPDCVAVDPRDPTRV |
| Ga0307479_103360732 | 3300031962 | Hardwood Forest Soil | MVGIIVVTRAAVLIARRASTWTVDEHLAGLSPGCVAVDVSS |
| Ga0307479_104742861 | 3300031962 | Hardwood Forest Soil | MVGIVVVTRAVLLIARRASTWTVDEHLAGLSPGCVAVDLSSPAQVYCGTARAG |
| Ga0307479_110431982 | 3300031962 | Hardwood Forest Soil | MVGIIVVTRAAVLIVRRASTWTVDEHLAGLSPGCVAVDP |
| Ga0307479_113521241 | 3300031962 | Hardwood Forest Soil | MVGIVVVTRAALLIARRASTWTIDEHLGGRSPECVAVDLRSPAQMYCGTA |
| Ga0318507_103280911 | 3300032025 | Soil | MVGIVVVTRAGLLIARRASTWTIDEHLGGRSPTSVAV |
| Ga0318506_100084213 | 3300032052 | Soil | MVAIVVVTRAGLLIARRASTWTIDEHLGGRSPECVAWP |
| Ga0318570_104801101 | 3300032054 | Soil | MVSITVVTRAALLIARRASTWTVDEHLGGRSPDSVAVDP |
| Ga0318505_104837312 | 3300032060 | Soil | MVSITVVTRAALLIARRASTWTVDEHLRGRSPACVAVDLRGPAQV |
| Ga0318525_106019752 | 3300032089 | Soil | MIRIVVVTRAALWIARRASTWTVDEHLGGRSPDCVAVDPRD |
| Ga0318577_101468261 | 3300032091 | Soil | MVSITVVTRAALLIARRASTWTVDEHLGGRSPDCVAV |
| Ga0318577_103550042 | 3300032091 | Soil | MVGFVVVTRAALLIARRASAWTIDEHLDGLSPECVAVDLRSPAKV |
| Ga0318540_102992512 | 3300032094 | Soil | MVGILVVTRAALLIARRASPWTVEEHLAGRSPVCVAVDPRDPTRLYCGTVRG |
| Ga0307470_108058121 | 3300032174 | Hardwood Forest Soil | VVGIVVVTRAALLIARRTSTWTIDARLAGLSPACVAVDPRTPAQVYCG |
| Ga0307471_1013384961 | 3300032180 | Hardwood Forest Soil | MGIVVVTRAALLIARRASTSTWTVDEHLGGRSPECLAVDPRDPA |
| Ga0307471_1023513712 | 3300032180 | Hardwood Forest Soil | MISIVVVTRAALLIGRRASTWTVDEHLGGRSPDCVTVDPRDPTRVYCGTAGA |
| Ga0307471_1024456141 | 3300032180 | Hardwood Forest Soil | MVGIAVVTRAAVLIARRASTWTVGEHLAGLSPGCLAVDLS |
| Ga0307472_1002458061 | 3300032205 | Hardwood Forest Soil | MAGLVVVTRAALLIARRASTWTIDEHLGGLSPECVAVDLRGPSRVY |
| Ga0307472_1019462571 | 3300032205 | Hardwood Forest Soil | MVGIVVVTRAALLIARRASTWTIDEHLGGRSPECVAVDRRAP |
| Ga0306920_1030870441 | 3300032261 | Soil | MAGFIVVTRAALLIARRASTWTVDEHLGGQSPECVAVDLRGPAQVYCGTARA |
| Ga0306920_1033857631 | 3300032261 | Soil | MVGIVVVTRAALLIARRASTWTIDEHLGGLSPTCVAVDVRGPAVYCGTARAGLFR |
| Ga0306920_1040261671 | 3300032261 | Soil | MVGIAVATRASLLIARRASTWTVAEHLNGQSPVCLAIDPRDPTRVYCGTARG |
| Ga0310914_103480321 | 3300033289 | Soil | MVGIVVVTRAGLLIARRASTWTIDEHLGGRSPTSVAVDPRRPAQVYCGTARAG |
| Ga0310914_106354851 | 3300033289 | Soil | MVSIVVVTQAALLIARRASTWSVEEHLGGRSLDCVAVDPRDPTRVY |
| ⦗Top⦘ |