NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F016139

Metagenome / Metatranscriptome Family F016139

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016139
Family Type Metagenome / Metatranscriptome
Number of Sequences 249
Average Sequence Length 151 residues
Representative Sequence LEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLISFHGLEELGIVVMVVVVSGGDGGESGENGEF
Number of Associated Samples 213
Number of Associated Scaffolds 249

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 29.27 %
% of genes near scaffold ends (potentially truncated) 74.70 %
% of genes from short scaffolds (< 2000 bps) 98.39 %
Associated GOLD sequencing projects 206
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.394 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(35.743 % of family members)
Environment Ontology (ENVO) Unclassified
(73.896 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.526 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.57%    β-sheet: 0.00%    Coil/Unstructured: 71.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 249 Family Scaffolds
PF0024414-3-3 0.40
PF13540RCC1_2 0.40



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.39 %
UnclassifiedrootN/A1.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001355|JGI20158J14315_10056940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1595Open in IMG/M
3300001355|JGI20158J14315_10130169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300002776|Ga0005234J37281_1013114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300003294|Ga0006245J48900_100971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300003299|Ga0006244J48909_1002194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300006714|Ga0079246_1227259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300007116|Ga0101667_1070869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300007231|Ga0075469_10205563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300007655|Ga0102825_1107507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300007716|Ga0102867_1101005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum768Open in IMG/M
3300007863|Ga0105744_1127315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300007864|Ga0105749_1172665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300007954|Ga0105739_1081026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300007956|Ga0105741_1145536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300008919|Ga0103484_1012298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300008928|Ga0103711_10057370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300009002|Ga0102810_1267452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300009006|Ga0103710_10179273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300009023|Ga0103928_10351698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300009024|Ga0102811_1319328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300009026|Ga0102829_1300257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300009028|Ga0103708_100133778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300009054|Ga0102826_1180169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300009071|Ga0115566_10804702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300009071|Ga0115566_10824885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300009172|Ga0114995_10824230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300009422|Ga0114998_10639221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300009432|Ga0115005_10759080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300009436|Ga0115008_11432064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300009497|Ga0115569_10249400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum798Open in IMG/M
3300009498|Ga0115568_10408939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300009544|Ga0115006_12214202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300010987|Ga0138324_10527873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300011312|Ga0138349_1049407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300012408|Ga0138265_1191653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300012414|Ga0138264_1073870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300012415|Ga0138263_1006177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300012416|Ga0138259_1148219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300012417|Ga0138262_1034813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300012419|Ga0138260_10783031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300012782|Ga0138268_1407538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300012954|Ga0163111_11512313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300013010|Ga0129327_10819192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300016689|Ga0182050_1046389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300016742|Ga0182052_1193073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300016762|Ga0182084_1256359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300016791|Ga0182095_1007335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300017714|Ga0181412_1113681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300017737|Ga0187218_1150983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300017746|Ga0181389_1097441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum812Open in IMG/M
3300017769|Ga0187221_1097781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum899Open in IMG/M
3300017952|Ga0181583_10857265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300017958|Ga0181582_10941885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300018048|Ga0181606_10673181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300018410|Ga0181561_10234420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum880Open in IMG/M
3300018415|Ga0181559_10787806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300018420|Ga0181563_10706251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018426|Ga0181566_11075206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300018515|Ga0192960_103957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300018567|Ga0188858_106190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300018567|Ga0188858_106191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300018574|Ga0188842_1008086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300018574|Ga0188842_1008603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300018601|Ga0188850_1016961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300018628|Ga0193355_1018245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300018628|Ga0193355_1020663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300018628|Ga0193355_1020800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300018658|Ga0192906_1030711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300018684|Ga0192983_1038946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300018692|Ga0192944_1028969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum799Open in IMG/M
3300018692|Ga0192944_1036833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300018692|Ga0192944_1046599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300018701|Ga0193405_1045339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300018725|Ga0193517_1061877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300018725|Ga0193517_1066376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300018741|Ga0193534_1052835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300018749|Ga0193392_1047471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018761|Ga0193063_1052653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300018762|Ga0192963_1063275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018766|Ga0193181_1049819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300018776|Ga0193407_1061322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300018779|Ga0193149_1041608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300018782|Ga0192832_1038929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300018798|Ga0193283_1060715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300018800|Ga0193306_1059427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300018810|Ga0193422_1072697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300018825|Ga0193048_1051446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300018825|Ga0193048_1060905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300018832|Ga0194240_1027026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018838|Ga0193302_1064850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300018838|Ga0193302_1083953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300018842|Ga0193219_1038964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300018870|Ga0193533_1109934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300018871|Ga0192978_1095232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300018876|Ga0181564_10767998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300018882|Ga0193471_1084595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300018885|Ga0193311_10058875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300018888|Ga0193304_1072662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300018888|Ga0193304_1084380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300018893|Ga0193258_1196428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300018893|Ga0193258_1199583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300018907|Ga0193548_10017591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300018913|Ga0192868_10046275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300018913|Ga0192868_10074177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300018922|Ga0193420_10082808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300018926|Ga0192989_10124370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300018926|Ga0192989_10124675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300018926|Ga0192989_10124677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300018928|Ga0193260_10088196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300018928|Ga0193260_10112030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300018948|Ga0192985_1211345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300018948|Ga0192985_1214810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300018948|Ga0192985_1226091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300018955|Ga0193379_10194142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300018961|Ga0193531_10270799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300018967|Ga0193178_10043709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300018968|Ga0192894_10293335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300018974|Ga0192873_10371551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300018976|Ga0193254_10123602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018980|Ga0192961_10154296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum698Open in IMG/M
3300018982|Ga0192947_10207487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300018989|Ga0193030_10314364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300018997|Ga0193257_10183386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300018998|Ga0193444_10142345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300018998|Ga0193444_10148529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300019010|Ga0193044_10159329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300019010|Ga0193044_10195786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300019017|Ga0193569_10339431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300019020|Ga0193538_10243586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300019022|Ga0192951_10209219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300019022|Ga0192951_10236639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300019022|Ga0192951_10300268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300019024|Ga0193535_10219325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300019031|Ga0193516_10182207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300019032|Ga0192869_10256683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum757Open in IMG/M
3300019032|Ga0192869_10277903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300019039|Ga0193123_10413975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300019048|Ga0192981_10266392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300019048|Ga0192981_10309539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300019049|Ga0193082_10469529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300019049|Ga0193082_10561424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300019083|Ga0188854_1007645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300019083|Ga0188854_1008167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300019084|Ga0193051_109913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300019100|Ga0193045_1050948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300019102|Ga0194243_1005055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300019111|Ga0193541_1059662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300019116|Ga0193243_1044765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300019120|Ga0193256_1062021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300019125|Ga0193104_1034919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300019125|Ga0193104_1038194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300019131|Ga0193249_1103574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300019133|Ga0193089_1103013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300019139|Ga0193047_1082821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300019141|Ga0193364_10129214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300019282|Ga0182075_1466827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300020207|Ga0181570_10416661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300021325|Ga0210301_1280876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300021334|Ga0206696_1206587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300021342|Ga0206691_1387191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300021342|Ga0206691_1550171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300021345|Ga0206688_10868584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300021355|Ga0206690_10060983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300021359|Ga0206689_10423618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300021359|Ga0206689_10429814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300021365|Ga0206123_10439580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300021866|Ga0063109_101397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300021872|Ga0063132_100095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300021874|Ga0063147_102517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300021899|Ga0063144_1000199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300021899|Ga0063144_1017750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300021908|Ga0063135_1008482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300021921|Ga0063870_1004106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300021924|Ga0063085_1000039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300021927|Ga0063103_1001102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300021928|Ga0063134_1019232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300021939|Ga0063095_1003876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300021941|Ga0063102_1000202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300021941|Ga0063102_1025807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300022375|Ga0210313_1029742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300022934|Ga0255781_10450529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300023555|Ga0232120_105861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300023676|Ga0232114_129956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300023685|Ga0228686_1056935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300023695|Ga0228680_1033495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300024346|Ga0244775_11515090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300025608|Ga0209654_1172352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300025620|Ga0209405_1099987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum835Open in IMG/M
3300025626|Ga0209716_1178175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300025701|Ga0209771_1221236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300025809|Ga0209199_1290862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300025879|Ga0209555_10349605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300025887|Ga0208544_10021873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum3414Open in IMG/M
3300026426|Ga0247570_1079789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300026448|Ga0247594_1066818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300026466|Ga0247598_1136942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300026471|Ga0247602_1113719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300026495|Ga0247571_1129166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300028109|Ga0247582_1058081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1011Open in IMG/M
3300028279|Ga0228613_1139131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300028282|Ga0256413_1276596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300028335|Ga0247566_1058704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300028405|Ga0306909_119269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300028412|Ga0306910_1046876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300028671|Ga0257132_1107045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300030721|Ga0308133_1037065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300030726|Ga0308126_1052742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300030780|Ga0073988_10025606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300030780|Ga0073988_12360232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300030788|Ga0073964_10024924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300030788|Ga0073964_10038910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300030857|Ga0073981_10003657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300030865|Ga0073972_11397849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300031004|Ga0073984_11280723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300031005|Ga0073974_1013482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300031126|Ga0073962_11973828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300031216|Ga0307980_1081951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300031224|Ga0307982_1130779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300031269|Ga0307983_1063848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300031403|Ga0307933_1189488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300031445|Ga0073952_12099524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300031569|Ga0307489_10985765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300031709|Ga0307385_10302097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300032146|Ga0315303_1122743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300032481|Ga0314668_10570322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300032491|Ga0314675_10533672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300032519|Ga0314676_10791767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300032520|Ga0314667_10525335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300032615|Ga0314674_10517691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300032616|Ga0314671_10767094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300032707|Ga0314687_10046357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium catenella1694Open in IMG/M
3300032707|Ga0314687_10128340Not Available1234Open in IMG/M
3300032708|Ga0314669_10512627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300032711|Ga0314681_10460332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum714Open in IMG/M
3300032713|Ga0314690_10534082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300032714|Ga0314686_10039432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1772Open in IMG/M
3300032729|Ga0314697_10382470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum626Open in IMG/M
3300032732|Ga0314711_10257784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum897Open in IMG/M
3300032733|Ga0314714_10676055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300032742|Ga0314710_10339660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300032743|Ga0314707_10572107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300032744|Ga0314705_10578672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300032750|Ga0314708_10395425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300032751|Ga0314694_10474610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300032754|Ga0314692_10632901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300033572|Ga0307390_10789032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine35.74%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.86%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater9.24%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.02%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.22%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.21%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.21%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.81%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.81%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.61%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.61%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.61%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.20%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.20%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.80%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.80%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.80%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.40%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.40%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.40%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.40%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.40%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.40%
Volcanic Co2 Seep SeawaterEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater0.40%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.40%
Bay WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water0.40%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300002776Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003294Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C27A4_35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003299Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C43A7_35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006714Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 DCM_B metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007116Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3EnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300008919Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NA1EnvironmentalOpen in IMG/M
3300008928Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300011312Marine microbial communities from the Deep Pacific Ocean - MP2100 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016689Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011509AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016762Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016791Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018567Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dTEnvironmentalOpen in IMG/M
3300018574Metatranscriptome of marine microbial communities from Baltic Sea - GS677_3p0_dTEnvironmentalOpen in IMG/M
3300018601Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018665Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018761Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002934 (ERX1789455-ERR1719449)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018798Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001604 (ERX1789622-ERR1719156)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018810Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002291 (ERX1789538-ERR1719380)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018893Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789445-ERR1719354)EnvironmentalOpen in IMG/M
3300018907Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX1399744-ERR1328122)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018922Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789394-ERR1719405)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019083Metatranscriptome of marine microbial communities from Baltic Sea - GS680_3p0_dTEnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019141Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001937 (ERX1789668-ERR1719463)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020207Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023555Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 89R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023676Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026426Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 23R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028405Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697 (v2)EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030726Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1292_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030865Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031126Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031216Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060EnvironmentalOpen in IMG/M
3300031224Marine microbial communities from Ellis Fjord, Antarctic Ocean - #989EnvironmentalOpen in IMG/M
3300031269Marine microbial communities from Ellis Fjord, Antarctic Ocean - #991EnvironmentalOpen in IMG/M
3300031403Saline water microbial communities from Organic Lake, Antarctica - #88EnvironmentalOpen in IMG/M
3300031445Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032146Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_Tmax_316 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20158J14315_1005694043300001355Pelagic MarineMSEVHSRSISFLAHTSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGFHLSGDLNEWLSIIESLKDSSGKSFLDVLDGSGLGNSGVTVSFSLSLLSLGKFGLEGDKELVLVHGLISFNGLEEFHVSVGVVVVSGSDGGDESSGGEFHCDCLEFIL*
JGI20158J14315_1013016923300001355Pelagic MarineMFSFIHSFLAHSSDINDLLEGLDGVLENWLDGLHDTESSLHIVDLWLHSLDGLHLSGDLNEWLSVIESLEDSSGKSLLDVLDGSGLGNSGVTVTLSFSRLSLGELGLEGNEELVFVHGLISFNGLEELSVVVVVVSGGNSGGEDGEFHL*
Ga0005234J37281_101311413300002776MarineMTEIPASFLRNRHCIS*Y*LSERSRRSFLAHSSDINDLLEGLDGILEDWLN*LHDTESSFHVVDLWLHSFDSFHLSSNFNKWLSIIESLQDSGSKGFLDVLDGSGLGNSGITISSRFG*KGSVQF*LE*YEKLVLIHGFISFHSFEELWLVMVMVMMMSGSNGGDESGVFH**
Ga0006245J48900_10097113300003294SeawaterMGSAWVIRSPLSDSLLAHASDIDDLLEGLDGVLKDWLDRLHDSESSLHVVDLGLHALNGLHLSGDLNEGLSVIESLEDSSGKSLLDVLDSGGLGNSGISVSTGLELLGLGELGLKRDEELVLIHGLVSLHSLEELGLVVSMVVVSGSSGGDQGEFH
Ga0006244J48909_100219413300003299SeawaterMLVGSVMGISSWSHRCSFLAHTSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGESLLDVLDGSGLGNGGIGITSGLKLERRVEVGLEGDEEVILVHGLISLHGLEELWLLVVVVVVSGGNSGGEESEFHGLK
Ga0079246_122725913300006714MarineLAWKQQTSIRVWGPSSCSFLAHSSNINDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSIIESLEDSGSKSFLDVLDSSGLGNGGIGITAGLESLSLVELGLKGDEELVLIHSLISLHGLEELSLVVVVVVVS
Ga0101667_107086913300007116Volcanic Co2 Seep SeawaterMYRAGSKLTNMMAFLKPSSCSFLAHSSDIDDLLEGLDGILKDWLDRLHDTESSLHIVDLWLHSLDGLHLSGDLNEWLSIIESLEDSSGEGLLDVLDGSGLGNGSVGITSGLKLLSLVELGLEGDEELVLVHGLISLHGLEELWLLVVVVVVSGGGDGGEESEFHGLK*
Ga0075469_1020556313300007231AqueousAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVKLGLEGDKELVLVHGLISFHGLEELGIVVMVVVVSGGDGGESGENGEFHFNFLYYKSGTYLINLYSSSVKFSL*
Ga0102825_110750713300007655EstuarineLEGLDGVLKDWLDGLHDSESSFHIVDLWLHSFDGLHLSGDFNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVSITSGLGGLSLGELGLEGNEELVFVHGLISLEGLKESRLVVVVLGRDGSDESDSSEFHLGLLIFYIISKSNINQNKQNKPNSFSGVLGFW
Ga0102867_110100523300007716EstuarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLISFHGLEELGIVVMVVVVSGGDGGESGENGEFHFNFLYYKSGTYLINLYSSSVKFSL*
Ga0105744_112731523300007863Estuary WaterLSGDSWCSFLTHASDINDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGIGVTSGLELLSLAELGLEGNKELVLVHGLVSLHGLEELGLVVVVVVSSGGDGGEESEFHVLK*
Ga0105749_117266523300007864Estuary WaterDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGIGVTSGLELLSLAELGLEGNKELVLVHGLVSLHGLEELGLVVVVVVSSGGDGGEESEFHVLK*
Ga0105739_108102613300007954Estuary WaterLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGGGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGFVSFLGLEKLGLVVVMVVVSLGSGGNGNKGEEFHVKFNF*
Ga0105741_114553623300007956Estuary WaterSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGIGVTSGLELLSLAELGLEGNKELVLVHGLVSLHGLEELGLVVVVVVSSGGDGGEESEFHVLK*
Ga0103484_101229813300008919Bay WaterVCSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGITVSSGLSGESHVELGLEGDKELVLVHVLVSLHGLEELSIVMVVVSGGDGGNEKAE
Ga0103711_1005737013300008928Ocean WaterLEGLDSILENWFNRLHDTESSLHIVDLGLHALDGLHLSSDLNEGLSIIESLEDSGSKSFLDVLDSSSLGNSGIGVTSGLRSEGLIELGAEGNKELVFVHGLISFHGLEELVIVMMMVVVSGGGSSDKSKGE
Ga0102810_126745213300009002EstuarineLEGLDGVLKDWLDGLHDSESSFHVVDLWLHAFDGLHLSGNFNEWLSIVKSLQDSSGKGLLNILDSGGLGNSGVSVSSGFGSLGLGELGLEGNEELVFVHGLISLHGLEKSGLVVVGVVLGGDGGDEGEGSEFHCGCLFVLNYYNSESGFLKTYLL*
Ga0103710_1017927313300009006Ocean WaterLEGLDSILENWFNRLHDTESSLHIVDLRLHALDGLHLSSDLNEGLSIIESLEDSGSKSFLDVLDSSSLGNSGIGVTSGLRSEGLIELGAEGNKELVFVHGLISFHGLEELVIVMMMVVVSGGGSSDKSKGEFH
Ga0103928_1035169813300009023Coastal WaterLEGLDSILENGFNRLHDTESSLHIVDLRLHALDGLHLSSDLNEGLSIIESLEDSGSKSFLDVLDSGGLGNSGIGVTSGLRSEGLIELGAEGNKELVFVHGLISFHGLEELVIVMMMVVVSGGGSSDKSKGEFH
Ga0102811_131932813300009024EstuarineDGGELCSFLAHSSDVNDLLEGLDGVLKDWLDGLHDSESSFHVVDLWLHAFDGLHLSGNFNEWLSIVKSLQDSSGKGLLNILDSGGLGNSGVSVSSGFGSLGLGELGLEGNEELVFVHGLISLHGLEKSGLVVVGVVLGGDGGDEGEGSEFHCGCLFVLNYYNSESGFLKTYLL*
Ga0102829_130025713300009026EstuarineDLLEGLDGVLKDWLDGLHDSESSFHVVDLWLHAFDGLHLSGNFNEWLSIVKSLQDSSGKGLLNILDSGGLGNSGVSVSSGFGSLGLGELGLEGNEELVFVHGLISLHGLEKSGLVVVGVVLGGDGGDEGEGSEFHCGCLFVLNYYNSESGFLKTYLL*
Ga0103708_10013377813300009028Ocean WaterLEGLDSILENWFNRLHDTESSLHIVDLGLHALDGLHLSSDLNEGLSIIESLEDSGSKSFLDVLDSSSLGNSGIGVTSGLRSEGLIELGAEGNKELVFVHGLISFHGLEELVIVMMMVFNMEIVHPSSQSPGHKRGPPRSSQATG*
Ga0102826_118016913300009054EstuarineVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGNFNEWLSIIESLEDSGGKSFLDVLDGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELVLVHGLISFNGFEELGGSVMVVVSGGDGSDKGSNGEFHYDCLEFIL*
Ga0115566_1080470223300009071Pelagic MarineHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGIGVTSGLELLSLAELGLEGNKELVLVHGLVSLHGLEELGLVVVVVVSSGGDGGEESEFHVLK*
Ga0115566_1082488513300009071Pelagic MarineDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKGFLDVLDGSGLGNGGITISSGLGGKGLGELGLEGDEELLFVHGLISFHGLEELGIVMMMVVVSGGDGGEGGKAGEFHFVLFIYYNLIAKIY*
Ga0114995_1082423023300009172MarineDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKGFLDVLDGSGLGNGGITISSGFGGKGLGELGLEGDEELLFVHGLISFHGLEELGIVMMMVVVSGGDGGEGGKAGEFHFVLFIYYNLIAKIY*
Ga0114998_1063922113300009422MarineSSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKGFLDVLDGSGLGNGGITISSGFGGKGLGELGLEGDEELLFVHGLISFHGLEELGIVMMMVVVSGGDGGEGGKAGEFHFVLFIYYNLIAKIY*
Ga0115005_1075908023300009432MarineLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFDGFHLSGNFNEWLSIIESLEDSSGKSFLDVLDGSGLGNSGVSVTFSLGLLGLGKFGLEGDKELILVHGLISFNGFEELGASVMVVMSGGNGGDEGSDGEFHCDCLEFIL*
Ga0115008_1143206423300009436MarineWLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGIGVTSGLELLSLAELGLEGNKELVLVHGLVSLHGLEELGLVVVVVVSSGGDGGKESEFHVLK*
Ga0115569_1024940013300009497Pelagic MarineLEGLDGVLENWLNRLHDTESSLHIVNLWLHTFDGLHLSGDLNEWLSIIKSLKDSSGKGFLDVLDGSGLGNGGITISSGLGCEGSVELGLEGDEELVFVHGFISFLGLEELGLVMVMVVSGGDGGGGKGEEFHVDYFYYL*
Ga0115568_1040893913300009498Pelagic MarineLNKLLSHSSDVNNLLESLNGVFKNWLNGLHDTKSSLHIVNLWLHTFDGLHLSGDLNEWLSIIKSLKDSSGKGFLDVLDGSGLGNGGITISSGLGCEGSVELGLEGDEELVFVHGFISFLGLEELGLVMVMVVSGGDGGGGKGEEFHVDYFYYL*
Ga0115006_1221420213300009544MarineGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLKDSGGKSFLDVLDGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNGFEELGGSVVMVVSGGDGSDKGSNGEFHCDCLEFIL*
Ga0138324_1052787313300010987MarineLEGLDGVLEDWLNGLHDTESSFHVVDLWLHAFDGLHLSGNFDEGLSIIKSLEDSGSEGLLDVLDGGGLGNSGISITSGFSREGHVELGIKRNKELVFVHGLVGFHGLKELGIMMMMMVVSGSGGSNESESKF
Ga0138349_104940713300011312Deep OceanMDLGKAEELRSLWSDVVCSFLAHASDIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGVSVTSGLELLSLGELGLEGNKELVLIHGLISLHGFEELWLMAVVVVSSGGDGGEESEFHVLK*
Ga0138265_119165313300012408Polar MarineLEGLDGVLENWLDGLHDTESSLHIVDLWLHSLDGLHLSGDLNKGLSIIKSLKDSSGKSLLDVLDGSGLGNSGVTVSLGLGVKGGSELGLEGDEKLVFVHGLISLHGLEKLGLVMMVMSGG
Ga0138264_107387013300012414Polar MarineLEGLDGILENWLYRLHDTESSLHIVDLWLHAFDGLHFSSDLNEWLSIIKSLKDSSGKSFLDVLNSSGFGNSGVSVSLGLGLLGLGKFGLERDKELILVHGLISFNGFEELGGSVMVVMSGGNGGDKSGDGE
Ga0138263_100617713300012415Polar MarineLEGLDGVLEDWLNRLHDSESSLHIVDLWLHAFDGLHLSGDLNEWLSIIESLKDSSGKSFLDVLDSGGLGNSGVSISLGLGLLGLGKFGLEGDKELILVHGLISFNGFEELGGSVMVVMSGGNGGDKSGDGEFHCD
Ga0138259_114821913300012416Polar MarineMHSFLSHSSDINDLLEGLDGILEYWLNRLHDTESSLHIVNLWLHAFDGLHLSGNFDEGLSIIKSLKDSSGKGFLDVLNSSGLGNSGITISSGLGFESSTELGLEGDKKLVLVHGFISFLGLEKLGISVMMVMMSGFDGNGKCGKGGEFH*
Ga0138262_103481313300012417Polar MarineLEGLDGILENWLYRLHDTESSLHIVDLWLHAFDGLHFSSDLNEWLSIIKSLKDSSGKSFLDVLNSSGFGNSGVSVSLGLGLLGLGKFGLERDKELILVHGLISFNGFEELGGSMMVVMSGGNGGDKGSDGEFHC
Ga0138260_1078303113300012419Polar MarineLEGLDGILENWLYRLHDTESSLHIVDLWLHAFDGLHFSSDLNEWLSIIKSLKDSSGKSFLDVLNSSGFGNSGVSVSLGLGLLGLGKFGLERDKELILVHGLISFNGFEELGGSMMVVMSGGNGGDKGSDGE
Ga0138268_140753813300012782Polar MarineLEGLDGVLENWLYRLHDTESSLHIVDLWLHAFDGLHFSSDLNEWLSIIKSLKDSSGKSFLDVLNSSGFGNSGVSVSLGLGLLGLGKFGLERDKELILVHGLISFNGFEELGGSVMVVMSGGNGGDKSGDGE
Ga0163111_1151231313300012954Surface SeawaterVLVLNGTFVDRVVSDSLLAHAADINDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLDEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGVTSGLKLLSLVELGLEGDEELVLVHGLISLHGLEQLWLLVVVVVVSGGGNGGEESEFHGLK*
Ga0129327_1081919223300013010Freshwater To Marine Saline GradientLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGIGVTSGLELLSLAELGLEGNKELVLVHGLVSLHGLEELGLVVVVVVSSGGDGGEESEFHVLK*
Ga0182050_104638913300016689Salt MarshMCSFLAHSSNVNDLLEGLDGVLENWLNRLHDSESSLHVVNLWLHSLDSLHLSGDLNEWLSIIKSLEDSSGKSLLDVLDGSGLGNSGVSISSGLSGLSLGELGLKGDKELVLVHGVVSLFGLEELSVVVVVVVSGSSRSNKGDSGEFHCLK
Ga0182052_119307313300016742Salt MarshMFLLSRIISFLAHSSDINNLLEGLDGVLENWLNRLHDTESSLHIVNLWLHTLDGLHFSGDLDEWLSIIKSLENSSSKGFLDVLNGSGLGNSGVTITSGLGGESLVKLGLEGDKELVLVHGLISLHGLEELRLVVVMVVSGGDGGESGENI
Ga0182084_125635913300016762Salt MarshMRQGLLGSHRVGLFIMESGCSFLSHSSDINDLLEGLDGVLEDWLNRLHDSESSLHIVDLWLHALDGLHLSGNFDEWLSIIESLEDSSGQGFLDVLDGSGLGNSGITVTSGLGGESLVELGLKGDKELVLVHGLVSLHGLEELGIVVMVVVVSGGDGGEGG
Ga0182095_100733513300016791Salt MarshHSSDINDLLEGFDGVLKNWLNGLHDTESSLHIVNLWLHTLDGLDFSGDLDEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLISLHGLEELGIVVMVVVVSGGDGGESGENGEFHFNFLYYKSSTYFINLYSSSVKFSL
Ga0181412_111368113300017714SeawaterMGSAWVIRSPLSDSLLAHASDIDDLLQGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGNFDEGLSVIESLEDSSGKSLLDVLDSGGLGNSGISVSTGLELLGLGELGLKRDEELVLIHGLVSLHSLEELGLVVSMVVVSGSSGGDQGEFH
Ga0187218_115098313300017737SeawaterSISLLAHTSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIESLQDSGGECLLDVLDGGGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLVSLHGLEELGIVVVMVVVSGGDGGDGKGGEFHFKKFLL
Ga0181389_109744113300017746SeawaterMGSAWVIRSPLSDSLLAHASDIDDLLEGLDGVLKDWLDRLHDSESSLHVVDLGLHALNGLHLSGDLNKGLSVIESLEDSSGKSLLDVLDSGGLGNSGISVSTGLELLGLGELGLKRDEELVLIHGLVSLHSLEELGLVVSMVVVSGSSGGDQGEFH
Ga0187221_109778123300017769SeawaterLHDTESSLHIVNLWLHALDGLHLSGDLDEWLSVIESLEDSGGEGLLDVLDGSGLGNSGVGVTSGLKLLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVVSGGGDGDEESEFHGL
Ga0181583_1085726513300017952Salt MarshLAHSSDINDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGEGLLDVLDGSGLGNSGITVTSGLGGESLVELGLKGDKELVLVHGLVSLHGLEELGIVVMVVVVSGGDGGEGGESGEFHFSLFNIYKNQQKNQLINKFR
Ga0181582_1094188513300017958Salt MarshDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHSLDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNSGITVTSGLGGESLVELGLKGDKELVLVHGLVSLHGLEELGIVVMVVVVSGGDGGEGGESGEFHFSLFNIYKNQQKNQLINKFR
Ga0181606_1067318113300018048Salt MarshSSDINDLLEGLDGVLEDWLNRLHDSESSLHVVDLWLHSLDSLHLSGDLNEWLSIIKSLEDSSGKSLLDVLDGSGLGNSGVSISSGLSGLSLGELGLKGDKELVLVHGVVSLFGLEELSVVVVVVVSGSSRSNKGDSGEFHCLKNLSIFNYIFAKWVSLSIKNRYISKIWGFGVLG
Ga0181561_1023442023300018410Salt MarshMIGMVVQIKASKQLTLKSRRSSLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLVSLHGLEELGIVVMVVVVSGGDGGESGENGEFHFNFLYYKSSTYFINLYSSSVKFSL
Ga0181559_1078780613300018415Salt MarshSSDINDLLEGLDGVLKDWLDGLHDSKSSLHVVDLWLHALDSLHLSGDLNEWLSIIKSLENSSGEGFLDVLDGSGLGNGGVSISSGLGLEGRVELRLKRDEELVLSHGVEGLLGSNKLDSGVVVVMSGGNGSNSKGEFHVKNFNNYNLSE
Ga0181563_1070625113300018420Salt MarshLEGLDCVLEDWLDGLHDTASSLHIVNLWLHTLDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGVTSGLELLSLGELGLKGNKELVLVHGLISLHGLEELWLVVVVVVSSGGDGGKESKFHVCK
Ga0181566_1107520613300018426Salt MarshSFLAHSSDINDLLEGLDGVLEDWLNRLHDSESSLHVVDLWLHSLDSLHLSGDLNEWLSIIKSLEDSSGKSLLDVLDGSGLGNSGVSISSGLSGLSLGELGLKGDKELVLVHGVVSLFGLEELSVVVVVVVSGSSRSNKGDSGEFHCLKNLSIFNYIFAKWVSLSIKNRYISKIWGFGVLG
Ga0192960_10395713300018515MarineVHDWRSAGSSSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNGFEELGGSVMVVVSGGNGGDESSDGEFHCDCLEFILSPCTLR
Ga0188858_10619013300018567Freshwater LakeMNNDSLICLRGWRGRCSFLSHSSDINDLLEGLDGVLKDWLDRLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVVVSGGNGGDGGEGEEFHL
Ga0188858_10619113300018567Freshwater LakeLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVVVSGGNGGDGGEGEEFHL
Ga0188842_100808613300018574Freshwater LakeMKKSGAGQEISHGTISLLAHSSDINDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSSGEGLLDVLDSSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLISLHGLEELSLVVVMVVSGRDGGESGEGSEFHLL
Ga0188842_100860313300018574Freshwater LakeMKKSGAGQEISHGTISLLAHSSDINDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIESLEDSSGKGLLDVLDGSGLGNSGVTVTSGLGGEGLVELGLEGNKELVLRHGLISFHGLEELGIVVMVVVSGGDGGESGKG
Ga0188850_101696113300018601Freshwater LakeVPQACSLLAHATDIDDLLEGLDGVLEDGLDGLHDTEAALHIVDLGLHALDRLHLAGDLDEGLAIVESLEDSGGEGLLDVLDGSGLGDGGIGITSGLGGESRREGGLEVDEELILVHGLDGGLGVNVLDVVVMVVVSGSGGSNKGEAELH
Ga0193355_101824513300018628MarineLINLNEHGSSLSVSFLAHATDIDDLLEGLDGVLEDGLDRLHDTESALHVVDLGLHALDGLHLPGDLDEGLSVIESLEDSGGEGLLDVLDGSGLGNGGIRVTSSLGGESGREGGLKGNKELVLVHGLNGGLGSDELVVVVSGGNSSDGESEFHCKLIIPM
Ga0193355_102066313300018628MarineLEGLDGVLEDWLDGLHDSESSLHIVDLWLHSLDGLHLSGDLDEWLSVIESLEDSSGKSLLDVLDGGGLGNSGVGITSGLGGESRREGVLEVDKELVLVHGLNSGLGVDVLVVVVMVVVSGSGGSNKGEAELHLILYYPH
Ga0193355_102080013300018628MarineMGSAWVIRSPLSDSLLAHASDIDDLLEGLDGVLENGLDGLHDTESSLHIVDLGLHALDGLHLSGDLNEGLSIIESLEDSSGEGLLDVLDGSGLGNGGIRVTSSLGGESGREGGLKGNKELVLVHGLNGGLGSDELVVVVSGGNSSDGESEFHCKLIIPM
Ga0192906_103071113300018658MarineVSYLVGETGVCSLLAHAADINDLLEGLDGVLEDGLDRLHDTEAALHIVDLGLHALDGLHLAGDLDEGLSIIKSLEDSGGEGLLDVLDGSGLGNGGVGVTSGLKLLSLVELGLEGNEELVLVHGLISLHGLEELWLLVVVVVVS
Ga0188882_102426313300018665Freshwater LakeCFLNKQVTNEQKLSSFTILLFIDLLTEISSALCISFLSHSSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLDEWLSVIKSLEDSSGKGFLDVLDGSGLGNGGVSISSGLGSLSLGELLLEGNEELVLVHGLVSLHGLKELSLVVVVSSGGSSNKC
Ga0192983_103894613300018684MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLMMMVVVSGGNGGDGGEGEEFHFDFIYLSPC
Ga0192944_102896923300018692MarineMCLRGWRGRCSFLSHSSDINDLLEGLDGVLKDWLDRLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVVVSGGNGGDGGEGEEFHFDFIYFPMYSALI
Ga0192944_103683313300018692MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGIGVTSGLELLGLGELGLEGNKELVLVHGLVSLHGLEELWLVVVVVVSSGGDGGEESEFHVEVNFNEFIN
Ga0192944_104659913300018692MarineLEGLDGVLKDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVVVSGGNGGDGGEGEEFHFDFIYFPMYSALI
Ga0193405_104533913300018701MarineLRSLWSDVVCSFLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDKWLSVIESLKDSSGKSLLDVLDSGGLGNGGITISSGLGSEGGIEIGLEGDKELVLGHSFVSFLGLEKLGLV
Ga0193517_106187713300018725MarineVCSLLAHTSDINDLLEGLDGVFEDWFDGLHDTKSSFHIINLWLHAFDGLHLSGNFNEWLSIIKSLEDSGSKSFLDVLDGSGLGNGGVSISLSFRSEGSVKFRLEGYKELVFIHGFISFHGLEELWLMMVVVVVSGGSGGNEGEEFHFGM
Ga0193517_106637613300018725MarineLVNKACQCSLLAHASDIDDLLEGLDGVLKDWLDGLHDSESSLHIVDLWLHALNSLHLSGDLNKGLSVIESLEDSSGKSLLDVLDSGGLGNSGISITSGLELLGLGELGLKRDEELVLIHSLISFHGLEELRLVVSMVVVSGSSGGDQGEFHSKKFNYPH
Ga0193534_105283513300018741MarineMDLGKAYELRSLWSDVVCSFLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDSGVSVTSGLELLGLGELGLEGNKELVLIHGLISLHGLEELWLVVVVVVSSGGDSGEICEFHVLK
Ga0193392_104747113300018749MarineMNHFRKESDCNKNHDGVASGGSSFLAHSSDINDLLEGLDGVLENWLNGLHDTESSLHIVDLWLHSLDGLHLSGDLNKWLSIIESLKDSSSKGFLDVLNGSGLGNSGITISSGFGSEGGIELGLERDEELVFVHGLISFLGLEKLGFVVVVVSSSSNGNKGE
Ga0193063_105265313300018761MarineVSYRVLATYGSSLLAHAADINDLLEGLDGVLEDGLNRLHDTEAALHVVDLGLHALNGLHLAGDLNEGLAVVESLQNTGGKSLLDVLDGSGLGDGGIGITAGLGLLGLSELGLERNEKLVLIHGLVSLKGLEEGVVVVVVVPGGGGGDEGKGE
Ga0192963_106327513300018762MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITISSGFGCEGGIELGLEGDEELVFVHGLISFHGLEELGIVMMMVVVSGGDGGDGSEKGEFH
Ga0193181_104981913300018766MarineVHFDSFQSTLGLSCSFLTHSSDIDDLLEGLDGVLENWLNGLHDTESSLHIVDLWLHTLDGLHLSGDLDEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGVTSGLKLLSLVELGLEGDEELVLVHGLISLHGLEELWLLVVVVVVSGGGNGGEESEFHGLK
Ga0193407_106132213300018776MarineEVNYHNNTWGFKPILCAFDSIQSLSFEISSFLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLENSGGEGLLDVLDGSGLGDGGVGVTSGLELLSLAELGLEGNKELVLVHGLISLHGLEELWLVVVVVVSSGGDGGEESEFHVLK
Ga0193149_104160813300018779MarineMSARLRSWCSFLAHSSDINDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSGGESLLDVLDGSGLGNGGIGVTSGLKLLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVVSGGNGGGEESEFHG
Ga0192832_103892913300018782MarineMICYLSNLACSFLAHTSDINDLLESLDGVLEDWLYGLHDTKSSFHIVNLWLHSLDGFHLSGDLNEWLSIIKSLKDSGSKSFLDVLDGSGLGNSGVSISLSFGSEGGVKFRLEGYKELVFVHGFISFHSLEKLWLMMVVVVVSGSGGGNESEEFHWY
Ga0193283_106071513300018798MarineMNHFREESDCNINHDGVASGGSSFLAHSSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHSLDGLHLSGDLNEWLSIIESLEDSGGEGLLDVLDGSGLGNSGVGVTSGLKLLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVVSGGGDGGEESEFHGLK
Ga0193306_105942713300018800MarineVCSFLTHTSDINDLLEGLDGVLEDWLDGLHDSESSLHIVNLWLHSLDGLHLSGNLNEWLSIIKSLEDSSSKSFLDVLDGSGLGNSGITVSSGFSGLGLSEFRLERDKELILVHGLISFNGFEEFSVSVVVVVSSGNSGNSKGEF
Ga0193422_107269713300018810MarineMVECVALRVLRTCDYQSLEVSFLAHATDINDLLEGLDGVLEDGLDGLHDTEAALHIVDLGLHALDGLHLAGNLDEGLAIIKSLEDSGGESLLDVLDGSGLGNGGVGVTSGLKLLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVVSGGGNGGEESEFHGLK
Ga0193048_105144613300018825MarineMYRAGSKLPNMMALGRPSRCSFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGITISSGLGSEGGIELGLEGDKELVLGHGFVSFLGLEKLGLVVVMVVSSLGSGGNGNKGKEFHV
Ga0193048_106090513300018825MarineVNNWSRRRCSFLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGITISSGLGSEGGIELGLEGDKELVLGHGFVSFLGLEKLGLVVVMVVSSLGSGGNGNKGKEFHV
Ga0194240_102702613300018832MarineLEGLDGILEYWFYGLHDTKSSFHIIDLWLHSLDGFHLSGNLNEWLSIIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLGELGLKGNKELLFVHGLISLHGLEELGIVMVMSVVSSGDGSEGGKSGEFHFDFLFNLFPM
Ga0193302_106485013300018838MarineLISINELGSSLSISFLAHATDIDDLLEGLDGVLEDGLDGLHDTEAALHIVDLGLHALDGLHLTGNLDEGLAIIKSLEDSGGQGLLDVLDGSGLGDGGIGITASLGLLGLVELGLKGDKELVLVHGLVSLHSLEESGVVVVVAGGNSDGSDSE
Ga0193302_108395313300018838MarineLEGLDSILENWFNRLHDTESSLHIVDLRLHALDGLHLSSDLNEGLSIIESLEDSGSKSFLDVLDSSGLGNSGIGVTSGLRSEGLIELGAEGNKELVFVHGLISFHGLEELVIVMMMVVVSGGGSSDKSKGE
Ga0193219_103896413300018842MarineMTRECSFLAHAADIDDLLEGLDGVLEDGLDRLHDTEAALHIVDLGLHALDGLHLTGNLDEGLAIIKSLEDSGGQSLLDVLDGSGLGDGGVGVTSGLELLSLAELGLEGNKELVLVHGLISLHGLEELWLVVVVVVSSGGDGGEESEFHVLK
Ga0193533_110993413300018870MarineVVTLESVRSSLLSHTSDINNLLEGLDGVLKDWLNRLHDTESSLHIVNLWLHSFDGLHLSGDLNEWLSIIESLEDSGGECLLDVLDGSGLGNGGIGVTSGLKLLSLVELGLEGNKELVLVHGLISLHGLEEL
Ga0192978_109523213300018871MarineVQTTGGSSFLAHSSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSIIESLEDSGGKSFLDVLDSSGLGNSGVSISLGLGLLGLGKFGLEGDKELILVHGLISFDGFEELGGSVMVVVSGSDSGDKGSNGEFHYDC
Ga0181564_1076799813300018876Salt MarshDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLISLHGLEELGIVVMVVVVSGGDGGESGENGEFHFNFLYYKSSTYFINLYSSSVKFSL
Ga0193471_108459513300018882MarineMQRLVVNVDELEGSLRISFLAHAADIDDLLEGLDGVLEDGLDRLHDTKSALHVVDLGLHALDGLHLSGNLDEGLTIIKSLEDSGSEGLLDVLDGSGLGDGGIRVTSSLGAEGLVELGLEGNKELVLVHGLVSLHGLEKLGVVGVVSGGGSNNSK
Ga0193311_1005887513300018885MarineMGVHTNSLCILIHFEAFRSSCSFLSHTSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGITSGLKLLSLAELGLEGDEELVLVHGLISLHGLEELWLVVVVVVSSGGDGGEESEFHVLK
Ga0193304_107266213300018888MarineMSDQLSHVVSVVRVRWCSFLSHTSDINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLDEWLSVIESLEDSGGEGLLDVLDGSGLGNGGIGITSGLKLLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVVSGGGNGGEESEFHGLK
Ga0193304_108438013300018888MarineVHFDSFQTCKSSCSFLAHTSDIDDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHSLDGLHLSGDLNEWLSIIESLEDSGGEGLLDVLDGSGLGNGGIGITSGLKLLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVVSGGGNGGEESEFHGLK
Ga0193258_119642813300018893MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSGGKSFLDVLDGSGLGNGGITISSGLGGKGLGELGLKRDEELLFVHGLISFHGLEELGIVVMMVVVSGGDGGEGGKAGEFHF
Ga0193258_119958313300018893MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVTITSGLGVEGVGELGLERDEELVFVHGLISFHGLEELGIVMMVVVSGRDGGEGSKNGEF
Ga0193548_1001759113300018907MarineVSYRVLATYGSSLLAHAADINDLLEGLDGVLKDGLDGLHDTEAALHIVDLGLHALDGLHLAGNLDEGLAIIKSLQNSGGEGLLDVLDGSGLGDGGVGVTSGLELLSLAELGLKGNKELVLVHGLISLHGLEELWLVVVVVVSSGGDGGEESEFP
Ga0192868_1004627513300018913MarineVWSSHVRCSLLSHSSDINDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFNEWLSIIESLEDSGGKGLLDVLDGSGLGNGGITISSGFGSEGGVELGLEGDEELVFVHGLISFLGLEKLGIMMSVVSGGGNGNKGEEFHFYFLIFSPC
Ga0192868_1007417713300018913MarineMGVQTKSVLDSRRELNELRCSFLSHSSDINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKSLLDVLDGSGLGNGGIGITSGLKLLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVV
Ga0193420_1008280813300018922MarineMNNYSLGWIRKRRSWCSFLSHSSDINDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSSLGNGGVTITSGLGGEGSGELGLKGDEELVFVHGLKGFHGLEELSFVWVMSMVSGRDGGEGSKG
Ga0192989_1012437013300018926MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVTITSGLGVEGVGELGLERDEELVFVHGLISFHGLEELGIVMMVVVSGRDGGEGSKNGEFH
Ga0192989_1012467513300018926MarineVVTLESVRSSLLSHTSNVNDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKGFLDVLDGSGLGNGGITISSGLGGKGLGELGLKRDEELLFVHGLISFHGLEELGIVVVMVVVSGGDGGEGGKAGEFHFC
Ga0192989_1012467713300018926MarineVVTLESVRSSLLSHTSNVNDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHTLDGLHLSGDLDEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLVSLHGLEELGIVVVMVVVSGGDGGEGGKAGEFHFC
Ga0193260_1008819613300018928MarineMLVGSAVKSDGLWQCSFLAHTSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLDEWLSIIKSLEDSGGEGLLDVLDGSGLGNGGIGITSGLKLLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVVSGGNGGGEESEFHG
Ga0193260_1011203013300018928MarineVSAWWCSLLSHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIESLKDSSGKSLLDVLDGGGLGNSGVTVSLGLSRLSLGELGLKRDEELVFVHGFISFNGLEELSVVVVVVSGGNSGGEDSEFH
Ga0192985_121134513300018948MarineLEGLDGVLEDWLNGLHDTESSLHIVDLWLHTFDGLHLSGDLDEWLSVIKSLEDSSGKGLLDVLDGSGLGNSGVTVSLGLGVKGGSELGLEGDEKLVFVHGLISLHGLEKLGLVMMVMSGGDGNDAKGSE
Ga0192985_121481013300018948MarineLECSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTFDGLHLSGDLNEWLSIIESLEDSGGKGLLDVLDGSGLGNSGVTVSLGLGVKGGSELGLEGDEKLVFVHGLISLHGLEKLGLVMMVMSGGDGNDAKGSE
Ga0192985_122609113300018948MarineMCSFLTHSSDIDDLLESLDSVLKDWLNRLHDSESSFHVIDLWLHAFNGLHLSSNFNEWLSIVKSLEDSGSEGLLDVLDGGSLGNSGISVTSSLGSLSLGELGLERDEELVFVHGLISFEGLKESRFLMVVVLGSDGSNESNSSEFHL
Ga0193379_1019414213300018955MarineMLSAWAERCSFLAHTSDVNDLLEGLDGILENWLNGLHDTESSLHIVDLWLHTLDGLHLSGDLNKWLSIIESLEDSSSKGFLDVLNGSGLGNSGITISSGFGSEGGIELGLERDEELVFVHGLISFLGLEKLGFVVVVVSSSSNGNKGEE
Ga0193531_1027079913300018961MarineMDLGKAYELRSLWSDVVCSFLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHSLDGLHLSGDLDEWLSIIESLEDSGGEGLLDVLDGSGLGDSGVSVTSGLELLGLGELGLEGNKELVLIHGLISLHGLEELWLVVVVVVSSGGDSGEICEFHVLK
Ga0193178_1004370913300018967MarineMRLVRQLDLQEFVSLVQEETIGSSLLAHATDIDDLLEGLDGVLEDGLDGLHDTEAALHIVDLGLHALDGLHLAGNLDEGLAIIKSLQNSGGEGLLDVLDGSGLGDGGVGVTSGLELLGLGELGLEGNKELVLIHGLISLHGLEELWVVVVVVVSSGGDGGEESEFHVLK
Ga0192894_1029333513300018968MarineMETIRNSKSPSGCSFLTHSSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHSLDGLHLSGDLNKWLSIIESLKNSSGESFLDILDGSSLSNSGITISHGLGIQGGGELGLERDEELFLIHGLISLHGLKELSLMM
Ga0192873_1037155113300018974MarineLIVEVVSDHQLRDKSSHCLGELGGSLRFSFLAHAADINDLLEGLDGVLEDGLDGLHDTESALHIVDLGLHALDGLHLPGDLDEGLTVIKSLEDSGGEGLLDVLDGSGLGDGGVSVTSGLELLSLGELGLEGNKELVLIHGLISLHSLEELWLMAVVVVSSGTEIT
Ga0193254_1012360213300018976MarineLECSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNKWLSIIESLKDSSGKSFLDVLDGGGLGNSGVVVSFSLSLLSLGKFGLEGDKELVLVHGLISFNGLEELGVSVVVVVSGSDSGDKGSDGEFHCDC
Ga0192961_1015429613300018980MarineLSKGRLRVQAVIIALSAVRCSFLAHTSNINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGFHLSGDFNEWLSIIKSLEDSGGKSFLDVLDGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNGFEELGGSVMVMVSGGDGSDKGSNGEFHYDCLEFIFPMYSAL
Ga0192947_1020748713300018982MarineMIPFNVECLHAVTSLSGVSVDTFISLLAHATDIDDLLEGLDGVLEDGLDGLHDTEAALHIVDLGLHALDGLHLAGDLDEGLAVIESLEDAGSEGLLDVLDGSGLGDGSIGITASLRLLGLVELGLKGDKELVLVHGLVSFHGLEKSGIVVVVVAGGNSDGSKSELHWIENIISH
Ga0193030_1031436413300018989MarineDWLDGLHDTESSLHIVDLWLHSLDGLHLSGDLNEWLSIIESLEDSSGKGLLDVLDGGGLGDGGVGITSVLEGLGFSELALKGDEELVLVHGLISLHGLEELSVVVVVVVVSGSDSGSESEEFHVK
Ga0193257_1018338613300018997MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVTITSGLGVEGVGELGLERDEELVFVHGLISFHGLEELGIVMMVVVSGRDGGEGSKNGEFHC
Ga0193444_1014234513300018998MarineMIELYDLTESDISLLAHASDIDDLLEGLDGVLEDWLDRLHDTESSLHIVDLGLHALDGLHLSGNLDEWLTVIESLEDSGGEGLLDVLDGSGLGDGGVGITSGLELLSLGELGLEGNKELVLVHGLISLHGLEELWLVVVVVVSSGGDGGEESEFHVLKSPC
Ga0193444_1014852913300018998MarineMGVHTNSLCILIHLEAFRSRCSFLTHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGVGITSGLELLSLGELGLEGNKELVLVHGLISLHGLEELWLVVVVVVSSGGDGGEESEFHVLKSPC
Ga0193044_1015932913300019010MarineLEGLDGVLEDGFDGLHDTESSFHIVDLWLHAFDGLHLSGNFDEGLSVIKSLEDSGGKGLLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVMVVSGGNGGDGGEGEEFHFDFIYLSPC
Ga0193044_1019578613300019010MarineVCSLLSHSSDINDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHALDGLHLSGNFNEWLSIIESLEDSGGKSFLDVLDGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELVLVHGLISFNSLEEFSVSVRVSVGVSGGSGGDESSDGEFHCDFLEFIFPM
Ga0193569_1033943113300019017MarineMIRLVVYLSLGCSFLSHSSDIDDFLEGLDGVLKDWLNGLHNTKSSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGVTSGLELLSLGELGLEGNKELVLVHGLISLHGLEELWLVVVVVVSSGGDSGEICEFHVLK
Ga0193538_1024358613300019020MarineMDLGKAYELRSLWSDVVCSFLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGNLDKWLSVIESLEDSGGEGLLDVLDGSGLGDSGVSVTSGLELLGLGELGLEGNKELVLIHGLISLHGLEELWLVVVVVVSSGGDSGEICEFHVLK
Ga0192951_1020921913300019022MarineLEGLDGVLEDGFDGLHDTESSFHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVVVSGGNGGDGGEGEEFHFDFIYLSPC
Ga0192951_1023663913300019022MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVVVSGGNGGDGGEGEEFHFDFIYLSPC
Ga0192951_1030026813300019022MarineMNHFREESNYNISHDEVSSTSISFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVVVSGGNGGDGGEGEEFHFDFIYLSPC
Ga0193535_1021932513300019024MarineVSYLVGKTDGSSLLAHAADINDLLEGLDGVLEDGLDRLHDTEAALHIVDLGLHALDGLHLAGDLDEGLSVIESLEDSGGEGLLDVLDGSGLGDSGVSVTSGLELLGLGELGLEGNKELVLIHGLISLHGLEELWLVVVVVVSSGGDSGEICEFHVLK
Ga0193516_1018220713300019031MarineMTQVYKFHKISFIDXLVSDTCSFLAHSSDINDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFNGLHLSGNFNEWLSIIESLEDSGGKSFLDVLDGSGLGNSGVSISSGFGXEGLVQFXLEXNKELVFVHGLISFLGLKELWLMMVVVVSGSNSG
Ga0192869_1025668313300019032MarineVLLNCSLLAHAADINDLLEGLDGVLKDGLNGLHDTKTALHIVDLGLHTLDGLHLTCDLDERLAIIESLQDSGGQGLLDVLNSGSLGDGGIGITAGLGLLGLAELGLKGDKELVLVHGLIGLHGLEEHGIVVVSGGSGGNESESELHWNKLLSPC
Ga0192869_1027790313300019032MarineMCSFLAHATDINDLLEGLDGVLKDGLDGLHDTEAALHIVDLGLHALDGLHLAGNLDEGLAIIKSLQNSGGEGLLDVLDGSGLGDGGVSVTSGLELLSLGELGLEGNKELVLIHGLISLHSLEELWLMAVVVVSSGGDGGEESEFHVLK
Ga0193123_1041397513300019039MarineVLITLIALDGTNIHLIQKVFSISFLAHASNIDDLLEGLDSVLKDWLDRLHNTKSSLHIVNLRLHSLDGLHLSSNLNEGLSIIESLKDSSSKSLLNVLDSSGLGNGGIRVTSSLGSEGRREGGLERNKELVLVHGLNSGLSVDVLVVVVMVVVSGGGSSNSESEFHRNLLSPC
Ga0192981_1026639213300019048MarineMCSFLSHTSDVNDLLEGLDGVLEDWFDRLHDTESSFHIVDLWLHTFDGFHLSGNFDEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLMMMVVVSGGNGGDGGEGEEFHFDFIYL
Ga0192981_1030953913300019048MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLMMMVVVSGGNGGDGGEGEEFHFDFIYL
Ga0193082_1046952913300019049MarineMSSWSWRGFSLLSHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLDEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGITSGLELLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVSGGGDGGEESEFHGLK
Ga0193082_1056142413300019049MarineVRCSLLSHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLDEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGITSGLELLSLVELGLEGNKELVLVHGLISLHGLEELWLLVVVVVSGGGDGGEESEFHGLK
Ga0188854_100764513300019083Freshwater LakeLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLISFHGLEELGIVVMVVVVSGGDGGESGENGEF
Ga0188854_100816713300019083Freshwater LakeVCSLLAHSSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLKDSGGKSFLDVLDGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNGFEELGGSVVMVVSGGDGSDKGSNGEFHCD
Ga0193051_10991313300019084MarineMLVGSVIKISSWSHRCSFLAHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSLLDVLDSGGLGNGGISVSTGLELLGLGELGLKRDEELVFVHGFVSFHGLEELSLVMVVVVSGSDGGDSE
Ga0193045_105094813300019100MarineMNNDSLIYLRGWRGGCSFLSHSSDINDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHTFDGLHLSGDLNKWLSIIESLEDSSGKSFLDVLDGSGLGNGGITISSGFGSEGGVELGLEGDEELVFVHGLISFLGLEKLGIMMSVVSGGGNGNKGEEFHFYFLI
Ga0194243_100505513300019102MarineMALIKPSSCSFLAHSSDINNLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGVTSGLELLGLGELGLEGNKELVLVHGLISLHGLEELWLVMVVVVLGSGNSGEECEFHVLK
Ga0193541_105966213300019111MarineMYRAGSKLTNMMAYLKPSSCSFLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDSGVSVTSGLELLGLGELGLEGNKELVLIHGLISLHGLEELWLVVVVVVSSGGDSGEICEFHVLK
Ga0193243_104476513300019116MarineMWVHRLNDQIQYVGIVLESVGRYSLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSFHIVDLWLHAFDGLHLSGNFNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGITISSGFGSEGGVELGLEGDEELVFVHGLISFLGLEKLGIVVSVVSGGGNGNKGEEFHFDFFNIFPH
Ga0193256_106202113300019120MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITISSGLGGKGLGELGLKRDEELLFVHGLISFHGLEELGIVVMMVVVSGGDGGEGGKAGEFHFC
Ga0193104_103491913300019125MarineLIPPPTPESGFGTQEGAFKVSQSDACRIWVNIKSGGLIWCSFLSHTSDINDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHTLDGLHLSGDLDEWLSIIKSLEDSGGEGLLDVLDGSGLGDSGVSVTSGLELLGLGELGLEGNKELVLIHGLISLHGLEELWLVVVVVVSSGGDSGEICEFHVLK
Ga0193104_103819413300019125MarineMSRCHSDWSSSFLAHSSDINDLLEGLDGVLEDWLNRLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDSGVSVTSGLELLGLGELGLEGNKELVLIHGLISLHGLEELWLVVVVVVSSGGDSGEICEFHVLK
Ga0193249_110357413300019131MarineMNTLLSGSSFLAHTTDIDDLLEGLDGVLEDWFNGLHDTESSFHIIDLWLHAFNGLHLSGNFNEGLSIIKSLEDSGSEGLLDVLDGSGLGNGGIGISSSFSGEGHVELGIERDKELVFVHSGEGFHGFEEFGIMVVMVVVSGSGSSNDGSEEF
Ga0193089_110301313300019133MarineMNNYSLGWKRGRRSGCSFLAHSSDINDLLEGLDGVLKDWLDGLHDTESSFHIVDLWLHSFDGLHLSGNFNEWLSVIESLEDSSGKCLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDEELVFVHGLISFHGLEELGIVVMMVVVSGGDGGEGGKAGEFHFCFVYLFSPC
Ga0193047_108282113300019139MarineMTHSYVYAGWRGRCSFLSHSSDINDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHTFDGLHLSGDLNEWLSVIESLEDSSGKGFLDVLDGSGLGNSGITISSGLGCEGSVELGLEGDEELIFVHGLISFLGLEELRIVGVMVVVSGGGDGNEGEEF
Ga0193364_1012921413300019141MarineLEGLDGVLKDWLDRLHNTKSSLHIVNLWLHALNGLHLSGNLDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGVGITSGLELLSLVELGLEGNEELVLIHGLISLHGLEELWLLVVVVVVSGGGDGGEESEFHGLK
Ga0182075_146682713300019282Salt MarshMDSFLAHSSNINNLLEGLNGVLKDWFNRLHDSESSLHIINLWLHAFNGLHFSSNLNEWLSIIESLEDSGSEGLLDVLNGSGLSNSGITISSSLSRESEVELGLERNEELIFVHGLISLHSLEKLWLSMVVVSVVLGGGSSDQSKGEFHC
Ga0181570_1041666113300020207Salt MarshLCCFANILLKYRTILLLYSLLAHSSDINNLLEGLDGVLENWLNRLHDTESSLHIVNLWLHTLDGLHFSGDLDEWLSIIKSLENSSSKGFLDVLNGSGLGNSGVTITSGLGGESLVKLGLEGDKELVLVHGLISLHGLEELRLVVVMVVSGGDGGESGENGEFHL
Ga0210301_128087613300021325EstuarineLCCFVNILLKYRTILLLYSLLAHSSDINNLLEGLDGVLENWLNRLHDTESSLHIVNLWLHTLDGLHFSGNLDEWLSIIKSLENSGSEGLLDVLDGSGLGNGGVTITSGLGGESLVKLGLEGDKELVLVHGLISFHGLEELGIVVMVVVV
Ga0206696_120658713300021334SeawaterLTSIELSFLAHSSNINNLLEGLDGILKDWFDRLHDSESSLHVIDLWLHAFNGFHLSGDLYEWLSIIESLKDSSGQSFLDVLDGSGLSNGGISISFSFGLLSLGEFRLEGDKELVLIHGLISFNGFEELTVMMVVVVSGSNCGNE
Ga0206691_138719113300021342SeawaterLEGLDGVLENWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIESLEDSGGESFLDVLDGSGLGNSGVTITSGLGVEGVGELGLERDEELVFVHGLISFHGLEELGIVMMVVVSGRDGGEGSKNGEFH
Ga0206691_155017113300021342SeawaterMLSCSSFLAHASNINNLLKGLDGVLKDWLDGLHDSKSPFHIVNLWLHAFNGLHLSGYLNQWLSIIQSLKDSGSKCFLDVFDGSSLSNGGVSVSFSFGRLGLGEFRLEGDKKLVLVHGFISFNGLEELGVSVVVMVSGSSGGNKTSDGEFH
Ga0206688_1086858413300021345SeawaterMFFRLFSRSGISFLSHSSNIDDLLEGLDGVLKYWLDGLHDSESSLHVINLGLHSFDGLHLSGNLNEWLSVIESLKDSGGEGLLDVLDGSGLGNGGVTISSGLGGESLSELGLEGDEELVFVHGFISLHGLEELSIMMMVVVVSGGD
Ga0206690_1006098313300021355SeawaterDKVCGSSFLAHSSDVDDLLEGLDGVLKDWLDGLHDSESSLHIVDLWLHAFDGLHLSGDLNKWLSVIESLEDSGGESLLDVLDGGGLGNGGISISSGLGTESGVEVGLEGDEELIFSHGIEGLLGLDEVLLSVEVVVVMSGINGDGEDGNSGEFHCCDLFNLVFYLN
Ga0206689_1042361813300021359SeawaterLPITHKLYGLRINYWFSTSLELSFLAHTSDINNLLEGLDGVFKDWFDGLHDTESSFHVIDLWLHAFDGLHLSSDLNEWLSIIESLKDSSGQSFLDVLDSSGLSNGGVSISFSFSLLGLGEFRLERYKELVLVHGFISFNGLEKF
Ga0206689_1042981413300021359SeawaterLEGLDGVLKDWFNGLHDSESSFHIINLWLHAFNGLHLSGDLNEWLSIIESLKDSSGKSFLDVLDGSGLGNGGVSISFSFSRLGLGEFGLERNKKLVLIHGFISFNGLEEFSVSVVVVVSGSSGGNKASDGEFH
Ga0206123_1043958013300021365SeawaterSFLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGNFDEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFLGLEKLGLVMVVVVSGGNGGDGGEGEEFHFDFIFYNELILID
Ga0063109_10139713300021866MarineMLKYGSSELKTNVFKFRGGLTGSDGACSFLAHASDIDDLLEGLDGVLKDWLDGLHDSESSLHIVDLWLHALNSLHLSGDLNKGLSIIESLEDSSGESLLDVLDSGGLGNSGISVSTGLELLGLGELGLKRDEELVFVHGLISFHGLEELRLVMMVVVSGSDGGDCE
Ga0063132_10009513300021872MarineMDLGKAYELRSLWSDVVCSFLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLDEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGVTSGLELLSLGELGLEGNKELVLVHGLISLHGLEELWLVVVVVVLGSGNSGEECEFHVLK
Ga0063147_10251713300021874MarineLEGLDGVLKNWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLKNSGGESFLDVLDGSSLGNGGVTISSGLGREGGSELGLERDEELVFVHGLISFHGLEKLGIVMMVVVSSRDGGDGSKASEFH
Ga0063144_100019913300021899MarineLEGLDGVLENWLNGLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSVIESLEDSGGKSFLDVLDGSGLGNGGVTITSGLGLLSLGKFGLEGDKELVLVHGLISLNGLEEFGVSVVVVVSGGDGSDKGSNGEFHC
Ga0063144_101775013300021899MarineMGISSWSHRCSFLAHTSDIDDLLEGLDGVLEDWLNGLHNTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVTISSGLGLLSLGKFRLEGDKELVLVHGLISLNGLEEFGVSVVVVVSGGDGSDKGSNGEFH
Ga0063135_100848213300021908MarineMDLGKAYELRSLWSDVVCSFLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGVSVTSGLELLGLGELGLEGNKELVLIHGLISLHGLEELWLVVVVVVSSGGDGGEESEFHVLK
Ga0063870_100410613300021921MarineLEGLDGVLKNWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLKNSGGESFLDVLDGSSLGNGGVTISSGLGREGGSELGLERDEELVFVHGLISFHGLEKLGIVMMVVVSGRDGGDGSKASEFH
Ga0063085_100003913300021924MarineMSHSYVYAGWRGRCSFLSHSSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSSGKSLLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLVSFLGLEKLGIVVVMVVVSLGGGGNGDKGEEFHVK
Ga0063103_100110223300021927MarineIDDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHTFDGLHLSGDLNEWLSIIESLEDSSGKSFLDILDGSGLGNSGVSVSFSFSRLSLGKFRLERDKELVLVHGLISFNSLEELGVSVMVVVSGFKLNES
Ga0063134_101923213300021928MarineMKSRSILFTGRRCSFLSHSSDINDLLEGLDGVLEDWFNGLHDTESSLHIIDLWLHAFNGLHLSGNFNEWLSIIESLKDSSGKSFLDVLDGGGLGNSGISITSVLGSESLVELGLEGDEELVFIHGFISFLGLKELWLMMVVVVSGGNNGNEESEFHCE
Ga0063095_100387613300021939MarineLEGLDGVLKNWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKGFLDVLDGSGLGNGGITISSGFGGKGLGELGLEGDEELLFVHGLISFHGLEELGIVMMMVVVSGGDGGEGGKAGEFHF
Ga0063102_100020213300021941MarineDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTFDGLHLSGDLNEWLSIIKSLEDSSSKSFLDILDGSGLGNSGVSVSFSFSRLSLGKFRLERDKELVLVHGLISFNSLEELGVSVMVVVSGFKLNES
Ga0063102_102580713300021941MarineMSVLYHSFLAHSSDINDLLEGLDGILENWLDRLHDTESSLHIVNLWLHAFDGLHLSGDLNEWLTIIESLEDSSGKSFLDVLDSSGLGNSGVSVSFGLGLLGLGKFGLEGNKELVLVHGLISFNGFEELGVVVVVVSGSDGGNEN
Ga0210313_102974213300022375EstuarineMKKSGAGQEISHGTISLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIESLEDSSGKSLLDVLDGSGLGNGGITISSGLRLEGGVELGLKGDEELIFVHVLEGGLGVNELVVVVVVVSRTMAGSARRMVFVA
Ga0255781_1045052913300022934Salt MarshHSSDINDLLEGLDGVLEDWLNRLHDSESSLHVVDLWLHSLDSLHLSGDLNEWLSIIKSLEDSSGKSLLDVLDGSGLGNSGVSISSGLSGLSLGELGLKGDKELVLVHGVVSLFGLEELSVVVVVVVSGSSRSNKGDSGEFHCLKNLSIFNYIFAKWVSLSIKNRYISKIWGFGVLG
Ga0232120_10586113300023555SeawaterLEGLDGVLEDWFDRLHDTESSLHIVDLWLHAFDGFHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVLVSGGNGDDGGEGEEFHFD
Ga0232114_12995613300023676SeawaterTADSTCSGYAVIDLGKAHELRSLWSDVVCSFLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIESLKDSSGEGLLDVLDGSSLGNGGVGVTSGLELLSLVELGLEGDEELVLVHGLISFHGLEELWLVVVVVVSGGGNGDEESEFHCLK
Ga0228686_105693513300023685SeawaterMTVVGHSDSSFLSHSSDINNLLEGVDGVLEDWLGGLHDSESSLHIVNLWLHSLDGLHFSSDLNEWLSIIESLKDSSGKGLLDVLNGGSLSNGSITISLGLGGEGGGELGLEGDEELVLIHGLISLHGLEELSLMMVSMVVSGGDDGKSKGGEFHFK
Ga0228680_103349513300023695SeawaterMGSLNRSFFINFNLSMVSLKELSSCSFLSHSSDIDDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGEGLLDVLDGSSLGNGGVGVTSGLELLSLVELGLEGDEELVLVHGLISFHGLEELWLVVVVVVSGGGSGDEESE
Ga0244775_1151509013300024346EstuarinePKTPKPLLNENIENERIICVVFVNILLKYRTILLLYSLLAHSSDINNLLEGLDGVLENWLNRLHDTESSLHIVNLWLHALDGLHFSGNLDEWLSIIKSLENSGSEGLLDVLDGSGLGNGGVTITSGLGGESLVKLGLEGDKELVLVHGLISLHGLEELRLVVVMVVSGGD
Ga0209654_117235213300025608MarineDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLISFHGLEELGIVVMVVVVSGGDGGESGENGEFHFNFLYYKSGTYLINLYSSSVKFSL
Ga0209405_109998713300025620Pelagic MarineMDNILFSLIILNMNHFREESDCKINHDGVASGGSSFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLRLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLISFHGLEELGIVVMVVVVSGGDGGESGENGEFHFNFLYYKSGTYLINLYSSSVKFSL
Ga0209716_117817513300025626Pelagic MarineDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLEDSGGKSFLDVLNGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNSLEEFGGSVVVVVSGGNGGDKGSNGEFHCDCFGIYIIIKNMLLL
Ga0209771_122123613300025701MarineSLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLISFHGLEELGIVVMVVVVSGGDGGESGENGEFHFNFLYYKSGTYLINLYSSSVKFSL
Ga0209199_129086213300025809Pelagic MarineLDGVLENWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLEDSGGKSFLDVLNGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNSLEEFGGSVVVVVSGGNGGDKGSNGEFHCDCFGIYIIIKNMLLL
Ga0209555_1034960523300025879MarineRKQTVEISLLAHSSDINNLLEGLDGVLENWLNRLHDTESSLHIVNLWLHALDGLHFSGNLDEWLSIIKSLENSGSEGLLDVLDGSGLGNGGVTITSGLGGESLVKLGLEGDKELVLVHGLISLHGLEELRLVVVMVVSGGDGGEGGENGEFHL
Ga0208544_1002187313300025887AqueousLHDSESSLHVVDLWLHALDGLHLSGDLNKGLSIIKSLENSSGKGFLDVLNGGGLGNGGIVNSMGLGVEGAGELGLEGDEELVIGHLIVGLNLDELVMVVVSGGDGSDECEGSEFHCFVLIIIMKIVSFVFITFLGFWGFG
Ga0247570_107978913300026426SeawaterVCSLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHMVDLWLHAFDGLHLSGDFNEWLSIIESLEDSGGKSFLDVLDGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELVLVHGLISFNGFEELGVVSVVVVSGGDGSDKGSNGEFHC
Ga0247594_106681813300026448SeawaterMSVCSFLAHTSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGDGGVSVTSGLELLSLGELGLEGNKELVLIHGLISLHSLEELWLMAVVVVSSGGDGGEESEFHVLK
Ga0247598_113694213300026466SeawaterMCSFLAHSSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSIIESLEDSGGKSFLDVLDGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELVLVHGLISFNGFEELGVVSVVVVSGGDGSDKGSNGEFHCD
Ga0247602_111371913300026471SeawaterLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIESLQDSGSKGLLDVLDGGGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLVSLHGLEELGIVVVMVVVSGGDGGDGGESGEFH
Ga0247571_112916613300026495SeawaterMSVCSFLAHTSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLKDSGGESLLDVLDGSGLGNGGIGVTSGLEGLGLGELGLEGNKELVLVHGLISLHGLEELWLVVVVVVSSAATAARKAN
Ga0247582_105808113300028109SeawaterVHLIHLLSASRRSCSFLAHTSDINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSIIESLQDSGSKGLLDVLDGGGLGNGGVTITSGLGGESLVELGLEGDKELVLVHGLVSLHGLEELGIMVVMVVVSGGDGG
Ga0228613_113913113300028279SeawaterLCISFLAHSSDIDDLLEGLDGVLEDWLNRLNDTESSLHIVDLWLHAFDGLHLSGDFNEWLSIIESLEDSGGKSFLDVLDGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELVLVHGLISFNGFEELGVVSVVVVSGGDGSDKGSNGEFHCDCLEFIL
Ga0256413_127659613300028282SeawaterVSALYHSFLAHSSDVNDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFDGFHLSGNFNEWLSIIKSLKDSSGKSFLDVLNGSGLGNSGVTVSLGLGLLGLGKFGLERDKELVLIHGLISFNGFEELGVVSVVVSGGDGSDKGSNGEF
Ga0247566_105870413300028335SeawaterVVTLQSVRSSLLSHTSDVNDLLEGLDGVLEDWLDGLHDTESSFHIVNLWLHALDGLHLSGNFNEWLSIIESLEDSGSKGFLDVLDGGGLGNSGVSITSGLRLLGVSESDLEFGKELVLVHGFVSFHGLEKLWLVMGVVVVVSGGDGSGEDAEFH
Ga0306909_11926913300028405Saline LakeVFSFLAHSSDIDNLLEGLDGVLKDWLNRLHDSESSLHVVDLWLHALDGLHLSGDLNKGLSIVKSLQDSSGKSLLDVLDGSGLGNGGISVSSGLSREGHLELGVEGDKELVLVHGLVGLHGLEECWLGMVSVVVLGSGGSDKSKGEFHF
Ga0306910_104687613300028412Saline LakeVFSFLAHSSDIDNFLEGLDGVLKDWLNRLHNSESSLHVVDLWLHALDGLHLSGDLNKGLSIVESLQDSSGKSLLDVLDGSGLGNGGISVSSGLSREGHLELGVEGDKELVLVHGLVGLHGLEECWLGMVSVVVLGSGGSDKSKGEFHF
Ga0257132_110704513300028671MarineMNNYSLGWKRGRRSGCSFLAHSSDINDLLEGLDGVLENWLDGLQDSVSSLHTVDLWLHALDGLHLSGDLDEWLSVIKSLEDSSGKGFLDVLDGSGLGNGGITISSGFGGKGLGELGLEGDEELLFVHGLISFHGLEELGIVMMMVVVSGGDGGEGGKAGEFH
Ga0308133_103706513300030721MarineVYSLLSHSSDINNLLEGLDGVLEDWLNGLHDSESSLHIVDLWLHAFDGLHLSGNLDEWLSIIKSLEDSGGKGLLDVLDGSGLGDGGVLISLGFEGHGLVELGLKGDEELVGVHGIVGLLGLEEVGLMMVVVVVSGFDGNSEEGNGGEF
Ga0308126_105274213300030726MarineMVITGIPASCLSIDIGCLYVNIVTWWSNFSFLSHSSDIDDLLEGLDGILEDWLNXLHDTESSFHIVDLWLHAFDGFHLSGNFDEWLSIIESLKDSSGKSFLDVLDGSGLGNGGITISSGFGXKGGVQFRLEGDKELVLVHGFISFHGFEKLWFMMVMVVMSGGDGGNEA
Ga0073988_1002560613300030780MarineMGVQTNSLCILIHFRSSGRSRSFLTHTSDIDELLEGLDGVLKDWLDGLHDTESSLHIIDLWLHTLDGLHLSGDLNEWLSVIESLKDSGGKSLLDVLDGSSLGNSGIGITSRFELLSLVELGLEGNEELVLIHGLISLHGLEELWLLVVVVVVSGGGNGGEESEFHGLK
Ga0073988_1236023213300030780MarineMICWSNLVCSFLAHTSDINDLLESLDGVLEDWLDGLHDTESSLHIVNLWLHTLDGLHLSGDLNEWLSVIESLKDSGGESLLDVLDGSGLGNGGIGVTSGLELLGLVELGLEGNKELVLVHGLISLHGLEELW
Ga0073964_1002492413300030788MarineLQGHSSEELLCSLLAHASDIDDLLEGLDGILKDWLDGLHDTKSSLHVIDLGLHTLDGLHLSGDLNEWLSIIESLEDSSGEGLLDVLDSGSLGNGGIGITSQLRGLGGGKLGLEGNKELVFVHVLVGLKSLEELRLSVAVVVVVSGGDGSNEKGEFHWSELINYNKSDDVGNE
Ga0073964_1003891013300030788MarineMRIGLELAALGLHGFDYSSLNWLHAYSLLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHVVDLGLHALDGLHLSGDLNEWLSIIESLEDSSGESLLDVLDGGGLGNGGIGITSGLRVESGVQGGLEGNKELVLVHGLKGHVGVDVLDVVMVVVVSGGDGSNKEGELHLEGNKELVL
Ga0073981_1000365713300030857MarineLEGLDGVLEDWFDGLHDTKSSFHIVDLWLHAFNGLHLSGNFNEWLSIIESLKDSGSKSFLDVLDGSGLGNSGVSISLSFGSEGSVKFRLEGYKELVFVHGFISFHSLEKLWLMMVVVVSSGSGGGNEGEEF
Ga0073972_1139784913300030865MarineLQGHSSEELLCSLLAHASDIDDLLEGLDGILKDWLDGLHDTKSSLHVIDLGLHTLDGLHLSGDLNEWLSIIESLEDSSGEGLLDVLDSGSLGNGGIGITSQLRGLGGGKLGLEGNKELVFVHVLVSLKSLEELRLSVAVVVVVSGGDGSNEKGEFHW
Ga0073984_1128072313300031004MarineLEGLDSILENGFNRLHDTESSLHIVDLRLHALDGLHLSGDLNKGLSIIESLEDSGSESFLDVLDSGGLGNSGIRVTSGLRSEGLIELGAEGNKELVFVHGLISFHGLKELGIGVMMMVVSSESGGDESEFH
Ga0073974_101348213300031005MarineVIRSPVRGSLLAHASNIDDLLEGLDGVLKDWLDRLHDSESSLHVVDLWLHALDGLHLSGDLNKGLSIIKSLEDSSGKSLLDVLDSGGLGNSGISVSTGLELLGLGELGLKRDEELVLIHGLVSLHSLEELRLVVMVVVSGSNGGDSK
Ga0073962_1197382813300031126MarineSFLAHASNIDDLLEGLDSVLKDWFDRLHNTKSSLHIVNLRLHALNGLHLSSNLNEGLSIIESLKDSSSKSLLDVLDSSGLSNGGIRVTSSLGSEGRREGGLERNEELVLVHGLNSGLGVDVLVVVVMVVVSGGSSSNSG
Ga0307980_108195113300031216Saline WaterVFSFLAHSSDIDNFLEGLDGVLKDWLNRLHNSESSLHVVDLWLHALDGLHLSGDLNKGLSIVKSLQDSSGKSLLDVLDGSGLGNGGISVSSGLSREGHLELGVEGDKELVLVHGLVGLHGLEECWLGMVSVVVLGSGGSDKSKGEFHF
Ga0307982_113077913300031224Saline WaterVFSFLAHSSDIDNLLEGLDGVLKDWLNRLHNSESSLHVVDLWLHALDGLHLSGDLNKGLSIVESLQDSSGKSLLDVLDGSGLGNGGISVSSGLSREGHLELGVEGDKELVLVHGLVGLHGLEECWLGMVSVVVLGSGGSDKSKGEFHF
Ga0307983_106384813300031269Saline WaterVFSFLAHSSDIDNLLEGLDGVLKDWLNRLHNSESSLHVVDLWLHALDGLHLSGDLNKGLSIVKSLQDSSGKSLLDVLDGSGLGNGGISVSSGLSREGHLELGVEGDKELVLVHGLVGLHGLEECWLGMVSVVVLGSGGSDKSKGEFHF
Ga0307933_118948813300031403Saline WaterVFSFLAHSSDIDNFLEGLDGVLKDWLNRLHNSESSLHVVDLWLHALDGLHLSGDLNKGLSIVKSLQDSSGKSLLDVLDGSGLGNGGISVSSGLSREGHLELGVEGDKELVLVHGLVGLHGLEEC
Ga0073952_1209952413300031445MarineMNNYSLGWIRRGRSWCSFLSHTSDINDLLEGLDGVLKDWLDGLHDTESSLHIVDLRLHALDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGSGLGNGGITITSGLGGEGLGELGLKRDEELVFVHGFISLHGLEEGIIMVVMVVVSGGS
Ga0307489_1098576513300031569Sackhole BrineMCSLLSHSSDINDLLEGFDGILKDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIKSLEDSSGKSLLDVLDGSGLGDGGISITSGLGVESLVKLGLEGNKELVLVHGLKSLHGLEELRLVVVMVVSSGDGGDGGDKGEFHLYCQN
Ga0307385_1030209713300031709MarineMGKSLLTHSSNIDDLLEGLDGVLEDWLDGLHDTESSLHIINLWLHSLDGLHLSGDLNEWLSVIESLQDSGGECLLDVLDGSGLGNSGISISSSLGRESLSELGLERDEELVFVHGLISFHGLEELGLVMVMVMSGNDGRDGESSEFH
Ga0315303_112274313300032146MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVVVSGGNGGDG
Ga0314668_1057032213300032481SeawaterLHFLGKIFLNIAETYCSFIYSFLAHSSDINDLLEGLDGVLENWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFNEWLSIIESLKDSGSEGFLDVLDGSGLGNGGITISSGLGFEGGIELGLEGDKKLVLGHGFISFFGFEKLGIMMVMVVVSGGNGGDGGEGEEFHL
Ga0314675_1053367213300032491SeawaterLEGLDGVLKDWLNGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKSLLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLVSFLGLEKLGIVVVMVVVSLGGGGNGDKGE
Ga0314689_1061129113300032518SeawaterFLNKQVTNEQKLSSFTILLFIDLLTEISSALCISFLSHSSDIDDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLEDSGGKSFLDVLNGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNSLEEFGGSVVVVVSGGKSFLDVLKGIGLGNSGVTDSL
Ga0314676_1079176713300032519SeawaterLEGLDGVLKDWLNGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKSLLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLVSFLGLEKLGIVVMMVVVSLGGGGNGDKGEEF
Ga0314667_1052533513300032520SeawaterLEGLDGVFKNWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKGFLDVLDGSGLGNGGITISSGLGGKGLGELGLEGDEELLFVHGLISFHGLEELGIVMMMVVVSGGDGGEGGKAGEFHFV
Ga0314674_1051769113300032615SeawaterMSHSYVYAGWRGRCSFLSHSSDIDDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLEDSGGKSFLDVLNGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNSLEEFGGSVVVVVSGGNGGDKGSNGEFHCD
Ga0314671_1076709413300032616SeawaterLFRKQSEYCSFLAHSSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKSLLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLVSFLGLEKLGIVVVMVVVSLGGGGNGDKGEEFHVKI
Ga0314687_1004635713300032707SeawaterAAHNLIRHDGDAARCFLNKQVTNEQKLSSFTILLFIDLLTEISSALCISFLSHSSDIDDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLEDSGGKSFLDVLNGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNSLEEFGGSVVVVVSGGNGGDKGSNGEFHCDPLTALLEIISIAFSIASISSARSC
Ga0314687_1012834013300032707SeawaterTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKGFLDVLDGSGLGNGGITISSGLGGKGLGELGLEGDEELLFVHGLISFHGLEELGIVMMMVVVSGGDGGEGGKAGEFLGMIPRSATLRVHGVRCTS
Ga0314669_1051262713300032708SeawaterMGISSWSHRCSFLAHTSDIDDLLEGLDGVLEDWLNRLHNTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLKNSGGESFLDVLDGSSLGNGGVTISSGLRRKGGSELGLERDEELVFVHGLISFHGLEKLGIVMMVVVSSRDGGDGSKASEFH
Ga0314681_1046033213300032711SeawaterLEGLDGVFKNWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLKNSGGESFLDVLDGSSLGNGGVTISSGLRRKGGSELGLERDEELVFVHGLISFHGLEKLGIVMMVVVSSRDGGDGSKASEFHC
Ga0314690_1053408213300032713SeawaterLHFLGKIFLNIAETYCSFIYSFLAHSSDINDLLEGLDGVLENWLDGLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKKLVLGHGFISFFGFEKLGIMMVMMVVSGGNGGDGGEGEEFHL
Ga0314686_1003943213300032714SeawaterDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLEDSGGKSFLDVLNGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNSLEEFGGSVVVVVSGGNGGDKGSNGEYRCRSWPVIRPCAQLPV
Ga0314697_1038247013300032729SeawaterLEGLDGVLKDWLNGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLVSFLGLEKLGIVVVMVVVSLGGGGNGDKGEEFHVKIND
Ga0314711_1025778413300032732SeawaterCSFLSHSSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKSLLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLVSFLGLEKLGIVVVMVVVSLGGGGNGDKGEEFHHAPARNPPYYRLGKSVRLLRRAA
Ga0314714_1067605513300032733SeawaterLEGLDGVLKDWLDGLHDSESSLHVVDLWLHALNGLHLSGNFDEWLSIIESLEDSSSERFLDVLDGSGLGNSGITISSGLGCEGGIELGLEGDKELVLGHGLVSFLGLEKLGIVVMMVVVSLGGGGNGDKGEEFHVNPLTRQDRPGPISTSLSIDSIRCEQVARRHR
Ga0314710_1033966013300032742SeawaterLEGLDGVLKDWLNGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKSLLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLVSFLGLEKLGIVVMMVVVSLGGGGNGDKGEEFHV
Ga0314707_1057210713300032743SeawaterLEGLDGVLKDWLNGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKSLLDVLDGSGIGNGGITISSGLGCEGGIELGLEGDKELVLGHGLVSFLGLEKLGIVVVMVVVSLGGGGNGDKGEEFHVK
Ga0314705_1057867213300032744SeawaterVQLALPELHHSLDMRCGSNSHLECSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKGFLDVLDGSGLGNGGITISSGLGGKGLGELGLEGDEELLFVHGLISFHGLEELGIVMMMVVVSGGDGGEGGKAGEFHF
Ga0314708_1039542513300032750SeawaterMGISSWSHRCSFLAHTSDIDDLLEGLDGVLEDWLNRLHNTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLKNSGGESFLDVLDGSSLGNGGVTISSGLRRKGGSELGLERDEELVFVHGLISFHGLEKLGIVMMVVVSSRDGGDGSKASEFHTEVTLGE
Ga0314694_1047037713300032751SeawaterKQVTNEQKLSSFTILLFIDLLTEISSALCISFLSHSSDIDDLLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLEDSGGKSFLDVLNGSGLGNSGVTVSLGLGLLGLGKFGLEGDKELILVHGLISFNSLEEFGGSVVVVVSGGNGGDKGSNGEFHCDC
Ga0314694_1047461013300032751SeawaterRKLHFLGKIFLNIAETYCSFIYSFLAHSSDINDLLEGLDGVLENWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFNEWLSIIESLKDSGSEGFLDVLDGSGLGNGGITISSGLGFEGGIELGLEGDKKLVLGHGFISFFGFEKLGIMMVMVVVSGGNGGDGGEGEEFHL
Ga0314692_1063290113300032754SeawaterLHFLGKIFLNIAETYCSFIYSFLAHSSDINDLLEGLDGVLENWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSSGKSFLDVLDGSGLGNGGITISSGLGCEGGIELGLEGDKELVLGHGLESFFGFEKLGLVMVVVVSGGNGGDGGEGEEFHFD
Ga0307390_1078903213300033572MarineMNHSYVYAGWRGRCSFLSHSSDINDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHTFDGLHLSGDFNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITISSGFGCEGGIELGLEGDEELVFVHGLISFLGLEKLGFMM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.