Metagenome / Metatranscriptome Family F013428

Overview

Basic Information

• Family ID: F013428
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 271
• Average Sequence Length: 42 residues
• Representative Sequence: MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
• Number of Associated Samples: 168
• Number of Associated Scaffolds: 271

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 60.52 %
• % of genes near scaffold ends (potentially truncated): 15.87 %
• % of genes from short scaffolds (< 2000 bps): 78.60 %
• Associated GOLD sequencing projects: 147
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (88.192 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (10.701 % of family members)
• Environment Ontology (ENVO): Unclassified (23.985 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (26.199 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 46.38%
  β-sheet: 0.00%
  Coil/Unstructured: 53.62%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 271 Family Scaffolds
PF00115	COX1	36.53
PF04442	CtaG_Cox11	33.95
PF00510	COX3	9.96
PF02104	SURF1	2.58
PF11137	DUF2909	1.48
PF13500	AAA_26	1.11
PF02790	COX2_TM	1.11
PF03334	PhaG_MnhG_YufB	0.74
PF01040	UbiA	0.74
PF00155	Aminotran_1_2	0.37
PF10003	DUF2244	0.37
PF06968	BATS	0.37
PF02386	TrkH	0.37
PF02628	COX15-CtaA	0.37
PF11104	PilM_2	0.37
PF01979	Amidohydro_1	0.37
PF07715	Plug	0.37
PF00116	COX2	0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 271 Family Scaffolds
COG3175	Cytochrome c oxidase assembly protein Cox11	Posttranslational modification, protein turnover, chaperones [O]	33.95
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	9.96
COG3346	Cytochrome oxidase assembly protein ShyY1	Posttranslational modification, protein turnover, chaperones [O]	2.58
COG1622	Heme/copper-type cytochrome/quinol oxidase, subunit 2	Energy production and conversion [C]	1.48
COG1320	Multisubunit Na+/H+ antiporter, MnhG subunit	Inorganic ion transport and metabolism [P]	0.74
COG0168	Trk-type K+ transport system, membrane component	Inorganic ion transport and metabolism [P]	0.37
COG1612	Heme A synthase	Coenzyme transport and metabolism [H]	0.37
COG4263	Nitrous oxide reductase	Inorganic ion transport and metabolism [P]	0.37

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	89.30 %
Unclassified	root	N/A	10.70 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	89.30 %
Unclassified	root	N/A	10.70 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	88.19 %
Unclassified	root	N/A	10.70 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.11 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	84.87 %
Unclassified	root	N/A	10.70 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.11 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.37 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.74 %

Level 5

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	73.06 %
Unclassified	root	N/A	10.70 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.11 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.37 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.37 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.74 %

Level 6

Name	Rank	Taxonomy	Distribution
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	14.39 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	13.28 %
Unclassified	root	N/A	10.70 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.37 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	0.37 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.74 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.74 %

Level 7

Name	Rank	Taxonomy	Distribution
Steroidobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae	13.28 %
unclassified Xanthomonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales	12.18 %
Unclassified	root	N/A	10.70 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.37 %
Thermomicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.74 %

Level 8

Name	Rank	Taxonomy	Distribution
Steroidobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples	0.37 %
Tolypothrichaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 9

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Tolypothrix	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 10

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
Tolypothrix campylonemoides	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides	0.37 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 11

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	0.37 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 12

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	0.37 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 13

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	0.37 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Tylenchina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 14

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	0.37 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Panagrolaimomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 15

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	0.37 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Strongyloidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 16

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	0.37 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Steinernematidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 17

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	0.37 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Steinernema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Level 18

Name	Rank	Taxonomy	Distribution
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13.28 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	12.18 %
Unclassified	root	N/A	10.70 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	0.37 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.37 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.37 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.37 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.37 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.37 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.37 %
Steinernema glaseri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	0.74 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.74 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000124|BS_KBA_SWE12_21mDRAFT_c10111802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	665
3300000134|BS_KBA_SWE07_21mDRAFT_c1027979	All Organisms → cellular organisms → Bacteria → Proteobacteria	621
3300001213|JGIcombinedJ13530_104913655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	544
3300002961|JGI11641J44799_10035823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1453
3300003371|JGI26145J50221_1022593	All Organisms → cellular organisms → Bacteria → Proteobacteria	614
3300003432|JGI20214J51088_10271773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1169
3300003858|Ga0031656_10012264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3591
3300003858|Ga0031656_10044944	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1775
3300003858|Ga0031656_10093091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1109
3300003859|Ga0031653_10036790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1352
3300003861|Ga0031654_10009990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2791
3300003991|Ga0055461_10132445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	647
3300004048|Ga0055494_10079373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	681
3300004050|Ga0055491_10107037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	698
3300004151|Ga0066602_10415465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	606
3300004154|Ga0066603_10491888	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	577
3300004155|Ga0066600_10278718	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	754
3300004155|Ga0066600_10679292	Not Available	521
3300004155|Ga0066600_10740511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	502
3300004156|Ga0062589_100044654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2420
3300004156|Ga0062589_100724234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	887
3300004463|Ga0063356_105829883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	528
3300004481|Ga0069718_10085624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1217
3300004643|Ga0062591_102563126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	537
3300004778|Ga0062383_10111371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1184
3300004778|Ga0062383_10295106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	776
3300004779|Ga0062380_10275635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	704
3300004781|Ga0062379_10032897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	970
3300004808|Ga0062381_10124331	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	833
3300005328|Ga0070676_10087857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1898
3300005331|Ga0070670_102073828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	524
3300005354|Ga0070675_100773321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	877
3300005655|Ga0073905_10425820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	559
3300005827|Ga0074478_1329118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1945
3300005829|Ga0074479_10189993	All Organisms → cellular organisms → Bacteria → Proteobacteria	1587
3300005833|Ga0074472_10078306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	883
3300005833|Ga0074472_10892568	All Organisms → cellular organisms → Bacteria → Proteobacteria	888
3300005836|Ga0074470_10665608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	672
3300005940|Ga0073913_10059132	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	620
3300006040|Ga0073914_10033537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	917
3300006092|Ga0082021_1004426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5826
3300006092|Ga0082021_1114038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	30466
3300006092|Ga0082021_1172796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	88926
3300006224|Ga0079037_100040736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3541
3300006224|Ga0079037_100042017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3498
3300006224|Ga0079037_100198666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1798
3300006224|Ga0079037_100392177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1312
3300006224|Ga0079037_100437291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1245
3300006224|Ga0079037_100744503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	959
3300006224|Ga0079037_101166305	All Organisms → cellular organisms → Bacteria → Proteobacteria	765
3300006224|Ga0079037_101254469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	737
3300006224|Ga0079037_101257766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	736
3300006224|Ga0079037_101319998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	718
3300006224|Ga0079037_101848719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	603
3300006606|Ga0074062_11581630	All Organisms → cellular organisms → Bacteria → Proteobacteria	521
3300006844|Ga0075428_100062316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4083
3300006844|Ga0075428_100447336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1384
3300006845|Ga0075421_100393697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1665
3300006930|Ga0079303_10027349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1890
3300006930|Ga0079303_10488034	All Organisms → cellular organisms → Bacteria → Proteobacteria	531
3300009009|Ga0105105_10256248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	929
3300009009|Ga0105105_10472723	Not Available	712
3300009009|Ga0105105_10532759	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	676
3300009068|Ga0114973_10000019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	98836
3300009075|Ga0105090_10000525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	18982
3300009075|Ga0105090_10022280	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	3903
3300009075|Ga0105090_10096472	Not Available	1851
3300009078|Ga0105106_10666458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	744
3300009091|Ga0102851_11067754	All Organisms → cellular organisms → Bacteria → Proteobacteria	882
3300009091|Ga0102851_12991098	Not Available	543
3300009091|Ga0102851_13411396	Not Available	510
3300009111|Ga0115026_11405490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	577
3300009120|Ga0117941_1081970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1408
3300009131|Ga0115027_11060021	Not Available	639
3300009147|Ga0114129_13047080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	549
3300009156|Ga0111538_10416659	All Organisms → cellular organisms → Bacteria	1701
3300009156|Ga0111538_13261806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	565
3300009165|Ga0105102_10143455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1158
3300009167|Ga0113563_10041615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3789
3300009167|Ga0113563_10090101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2772
3300009167|Ga0113563_11023990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	952
3300009167|Ga0113563_13196780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	555
3300009169|Ga0105097_10248610	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	980
3300009455|Ga0114939_10000426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	35429
3300009455|Ga0114939_10007899	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	6034
3300009455|Ga0114939_10040485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2046
3300009506|Ga0118657_10004961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	21765
3300009506|Ga0118657_10064030	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5557
3300009506|Ga0118657_11366540	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	843
3300009509|Ga0123573_10177595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2114
3300009509|Ga0123573_10339258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	1449
3300009527|Ga0114942_1160911	All Organisms → cellular organisms → Bacteria → Proteobacteria	789
3300009540|Ga0073899_11127926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	548
3300009609|Ga0105347_1263456	Not Available	712
3300009610|Ga0105340_1213391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	816
3300009693|Ga0116141_10452688	All Organisms → cellular organisms → Bacteria → Proteobacteria	652
3300009868|Ga0130016_10219000	All Organisms → cellular organisms → Bacteria → Proteobacteria	1417
3300009868|Ga0130016_10566050	All Organisms → cellular organisms → Bacteria → Proteobacteria	714
3300009870|Ga0131092_10101096	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3400
3300009870|Ga0131092_10713261	All Organisms → cellular organisms → Bacteria → Proteobacteria	853
3300009870|Ga0131092_10898432	Not Available	728
3300010400|Ga0134122_10274599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1435
3300010412|Ga0136852_10006154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	13335
3300010997|Ga0139324_1004183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	2180
3300012990|Ga0159060_1143096	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	669
3300013769|Ga0119887_1001660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	8764
3300013769|Ga0119887_1002210	All Organisms → cellular organisms → Bacteria → Proteobacteria	7296
3300014260|Ga0075307_1002327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2894
3300014295|Ga0075305_1141452	All Organisms → cellular organisms → Bacteria → Proteobacteria	513
3300014298|Ga0075341_1009177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1198
3300014315|Ga0075350_1061623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	826
3300014316|Ga0075339_1008081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2314
3300014319|Ga0075348_1220720	Not Available	532
3300014322|Ga0075355_1172709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	587
3300014864|Ga0180068_1052743	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	670
3300014885|Ga0180063_1025943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1619
3300017792|Ga0163161_12102681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	502
3300017965|Ga0190266_10117773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1129
3300018029|Ga0187787_10345208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	572
3300018083|Ga0184628_10320956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	813
3300018083|Ga0184628_10656268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	526
3300018422|Ga0190265_10923513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	995
3300018429|Ga0190272_10222892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1387
3300018469|Ga0190270_11356508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	756
3300018476|Ga0190274_10333849	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1432
3300018481|Ga0190271_11338742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	836
3300021859|Ga0210334_10252426	All Organisms → cellular organisms → Bacteria → Proteobacteria	809
3300022204|Ga0224496_10080311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1440
3300022213|Ga0224500_10000916	All Organisms → cellular organisms → Bacteria → Proteobacteria	18459
3300022213|Ga0224500_10097337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1124
3300022213|Ga0224500_10103957	Not Available	1082
3300022214|Ga0224505_10000304	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	34253
3300022214|Ga0224505_10028178	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2454
3300022221|Ga0224506_10218477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	875
3300022549|Ga0212091_10167359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	876
3300023073|Ga0247744_1012813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1134
3300024056|Ga0124853_1010951	Not Available	1922
3300024056|Ga0124853_1439750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2523
3300024056|Ga0124853_1455644	Not Available	1908
3300025106|Ga0209398_1002812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	7639
3300025130|Ga0209594_1001371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	12232
3300025130|Ga0209594_1004385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	6345
3300025550|Ga0210098_1041525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	734
3300025555|Ga0210121_1003296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3173
3300025908|Ga0207643_10479498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	794
3300025925|Ga0207650_11337315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	610
3300025948|Ga0210088_1019652	Not Available	1017
3300025968|Ga0210103_1009532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1732
3300025975|Ga0210091_1013574	Not Available	782
3300025980|Ga0210137_1045916	Not Available	637
3300026485|Ga0256805_1015523	All Organisms → cellular organisms → Bacteria → Proteobacteria	839
3300027683|Ga0209392_1004781	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	3899
3300027683|Ga0209392_1065740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1172
3300027683|Ga0209392_1088244	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	992
3300027693|Ga0209704_1117533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	762
3300027715|Ga0208665_10006992	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2632
3300027716|Ga0209682_10006301	All Organisms → cellular organisms → Bacteria	3116
3300027721|Ga0209492_1308282	All Organisms → cellular organisms → Bacteria → Proteobacteria	526
3300027778|Ga0209464_10083662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1080
3300027778|Ga0209464_10253562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	635
3300027778|Ga0209464_10380658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	519
3300027796|Ga0209373_10314468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	635
3300027802|Ga0209476_10331047	Not Available	656
3300027831|Ga0209797_10037445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2188
3300027841|Ga0209262_10021488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	2743
3300027841|Ga0209262_10110106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1300
3300027841|Ga0209262_10179217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1021
3300027841|Ga0209262_10208664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	946
3300027841|Ga0209262_10458604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	621
3300027871|Ga0209397_10637386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	534
3300027877|Ga0209293_10364897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	743
3300027885|Ga0209450_10020031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	3772
3300027885|Ga0209450_10040717	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2808
3300027885|Ga0209450_10113971	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1816
3300027885|Ga0209450_10285712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1189
3300027885|Ga0209450_10471316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	919
3300027887|Ga0208980_10005595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	7533
3300027890|Ga0209496_10144969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1078
3300027890|Ga0209496_10333398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	770
3300027897|Ga0209254_10230631	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1459
3300027899|Ga0209668_10087757	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1780
3300027899|Ga0209668_10131951	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1494
3300027899|Ga0209668_10134174	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1483
3300027899|Ga0209668_10159549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1375
3300027899|Ga0209668_10219730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1191
3300027899|Ga0209668_10222623	All Organisms → cellular organisms → Bacteria → Proteobacteria	1184
3300027899|Ga0209668_10353646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	954
3300027899|Ga0209668_10419523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	878
3300027900|Ga0209253_10007747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	9257
3300027900|Ga0209253_10376319	All Organisms → cellular organisms → Bacteria → Proteobacteria	1084
3300027900|Ga0209253_10623241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	788
3300027900|Ga0209253_10876554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	631
3300027902|Ga0209048_10010036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	8531
3300027902|Ga0209048_10073057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	2712
3300027909|Ga0209382_10092127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	3560
3300027917|Ga0209536_101017576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1021
3300027972|Ga0209079_10005856	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4232
3300027972|Ga0209079_10194738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	693
3300028647|Ga0272412_1082457	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	1370
3300030606|Ga0299906_10033976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4075
3300030619|Ga0268386_10000026	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	70554
3300031665|Ga0316575_10053915	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1601
3300031772|Ga0315288_10348876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	1523
3300031834|Ga0315290_10099383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	2450
3300031834|Ga0315290_10223242	All Organisms → cellular organisms → Bacteria → Proteobacteria	1641
3300031834|Ga0315290_10245891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1561
3300031834|Ga0315290_10341313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1312
3300031834|Ga0315290_10341887	All Organisms → cellular organisms → Eukaryota	1311
3300031857|Ga0315909_10942372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	528
3300031873|Ga0315297_10008687	All Organisms → cellular organisms → Bacteria → Proteobacteria	6851
3300031873|Ga0315297_10433045	Not Available	1104
3300031873|Ga0315297_10613431	Not Available	913
3300031940|Ga0310901_10001979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4583
3300031997|Ga0315278_10614324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1112
3300032092|Ga0315905_11178898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	627
3300032143|Ga0315292_10763087	All Organisms → cellular organisms → Bacteria → Proteobacteria	811
3300032156|Ga0315295_11615075	Not Available	621
3300032164|Ga0315283_11878692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	600
3300032177|Ga0315276_11120846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	832
3300032180|Ga0307471_103876779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	529
3300032256|Ga0315271_10647728	Not Available	905
3300032256|Ga0315271_10901072	Not Available	763
3300032256|Ga0315271_11526202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	575
3300032342|Ga0315286_11720265	All Organisms → cellular organisms → Bacteria → Proteobacteria	593
3300032397|Ga0315287_10003671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	14828
3300032397|Ga0315287_10501179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1441
3300032397|Ga0315287_11079968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	930
3300032397|Ga0315287_11087866	All Organisms → cellular organisms → Bacteria → Proteobacteria	926
3300032397|Ga0315287_12463147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	560
3300033004|Ga0335084_11517655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	662
3300033406|Ga0316604_10512713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	659
3300033406|Ga0316604_10798913	Not Available	518
3300033406|Ga0316604_10837385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	505
3300033408|Ga0316605_10666920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	978
3300033408|Ga0316605_11426013	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	671
3300033408|Ga0316605_11434669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	669
3300033408|Ga0316605_11496931	All Organisms → cellular organisms → Bacteria → Proteobacteria	655
3300033408|Ga0316605_12151818	Not Available	543
3300033408|Ga0316605_12349165	Not Available	518
3300033408|Ga0316605_12433785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	509
3300033413|Ga0316603_10421679	All Organisms → cellular organisms → Bacteria → Proteobacteria	1210
3300033413|Ga0316603_10582956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1036
3300033413|Ga0316603_10718849	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	934
3300033413|Ga0316603_12255987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	513
3300033414|Ga0316619_10584764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	925
3300033414|Ga0316619_10612182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	907
3300033418|Ga0316625_100396461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1039
3300033418|Ga0316625_101426421	All Organisms → cellular organisms → Bacteria → Proteobacteria	650
3300033418|Ga0316625_102436520	Not Available	527
3300033419|Ga0316601_100599574	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1070
3300033419|Ga0316601_101156488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	775
3300033434|Ga0316613_10108975	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1700
3300033482|Ga0316627_100127642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1817
3300033482|Ga0316627_100528569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1055
3300033483|Ga0316629_11316373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	582
3300033485|Ga0316626_10232673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1467
3300033485|Ga0316626_10370363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1188
3300033487|Ga0316630_10021277	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	3536
3300034052|Ga0373889_010515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	1259
3300034052|Ga0373889_021643	Not Available	929
3300034054|Ga0373891_033730	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	785
3300034128|Ga0370490_0022335	All Organisms → cellular organisms → Bacteria	2117
3300034148|Ga0364927_0116407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	752
3300034149|Ga0364929_0261250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	584
3300034149|Ga0364929_0267749	Not Available	578
3300034150|Ga0364933_168268	Not Available	570
3300034151|Ga0364935_0017066	All Organisms → cellular organisms → Bacteria	1922
3300034169|Ga0370480_0004625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	5057
3300034176|Ga0364931_0014685	All Organisms → cellular organisms → Bacteria	2130
3300034194|Ga0370499_0203000	Not Available	533
3300034196|Ga0370503_0229346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	666

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	87.08%
Engineered	Engineered	7.01%
Host-Associated	Host-Associated	5.90%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	61.99%
Terrestrial	Environmental → Terrestrial	25.09%
Plants	Host-Associated → Plants	5.90%
Wastewater	Engineered → Wastewater	5.90%
Bioremediation	Engineered → Bioremediation	1.11%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	46.49%
Soil	Environmental → Terrestrial → Soil	21.77%
Marine	Environmental → Aquatic → Marine	9.96%
Sediment	Environmental → Aquatic → Sediment	5.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.43%
Activated Sludge	Engineered → Wastewater → Activated Sludge	4.43%
Floodplain	Environmental → Terrestrial → Floodplain	2.21%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.48%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.11%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	1.11%
Metal	Engineered → Bioremediation → Metal	1.11%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.37%

Type

Habitat	Taxonomy	Distribution
Wetlands	Environmental → Terrestrial → Soil → Wetlands	15.13%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	12.18%
Lentic	Environmental → Aquatic → Freshwater → Lentic	9.23%
Lake	Environmental → Aquatic → Freshwater → Lake	8.86%
Sediment	Environmental → Aquatic → Freshwater → Sediment	8.49%
Wetlands	Environmental → Aquatic → Marine → Wetlands	6.64%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	5.90%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.54%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	4.43%
Pond	Environmental → Aquatic → Freshwater → Pond	4.06%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	2.95%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.95%
Sediment	Environmental → Aquatic → Marine → Sediment	2.58%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	2.21%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.48%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.48%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.11%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	1.11%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.74%
Sand	Environmental → Terrestrial → Soil → Sand	0.74%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified	0.74%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.37%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.37%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.37%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.37%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	15.13%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	11.44%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	9.23%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	8.49%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	8.49%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.54%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	4.43%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	4.06%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	3.32%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	3.32%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.69%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	2.95%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.95%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	2.58%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	2.21%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.48%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.11%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	1.11%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.74%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.74%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.74%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified	0.74%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.37%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	0.37%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.37%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.37%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.37%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.37%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.37%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	10.70%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	9.23%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	8.49%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	7.75%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	5.90%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	4.06%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	3.32%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	3.69%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	2.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.95%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	2.58%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.58%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.58%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	2.21%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	2.21%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.85%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	1.48%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.48%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.48%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	1.48%
Mangrove Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment	1.11%
Mangrove Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment	1.11%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.11%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.11%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	1.11%
Wastewater Treatment Plant	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant	1.11%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	1.11%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.74%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.74%
Marine	Environmental → Aquatic → Marine → Wetlands → Sediment → Marine	0.74%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.74%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.74%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.74%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.74%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.74%
Sewage Treatment Plant	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant	0.74%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.37%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.37%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	0.37%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.37%
Lake Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment	0.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.37%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.37%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.37%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.37%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.37%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.37%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.37%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000124	Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m	Environmental
3300000134	Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 07_21m	Environmental
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental
3300002961	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk	Environmental
3300003371	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM	Host-Associated
3300003432	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental
3300003858	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI	Environmental
3300003859	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR	Environmental
3300003861	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR	Environmental
3300003991	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1	Environmental
3300004048	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2	Environmental
3300004050	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2	Environmental
3300004151	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5	Environmental
3300004154	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8	Environmental
3300004155	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11	Environmental
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental
3300004779	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh	Environmental
3300004781	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh	Environmental
3300004808	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh	Environmental
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated
3300005655	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant	Engineered
3300005827	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA	Environmental
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental
3300005940	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14	Environmental
3300006040	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_30-Apr-14	Environmental
3300006092	Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore	Engineered
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006930	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC	Environmental
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental
3300009120	Lake sediment microbial communities from Tanners Lake, St. Paul, MN	Environmental
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental
3300009455	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring	Environmental
3300009506	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8	Environmental
3300009509	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11	Environmental
3300009527	Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek	Environmental
3300009540	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph	Engineered
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental
3300009693	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG	Engineered
3300009868	Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant	Engineered
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010412	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10	Environmental
3300010997	ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)	Environmental
3300012990	Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015	Engineered
3300013769	Sewage treatment plant microbial communities from Vermont, USA - Sand_B	Engineered
3300014260	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd	Environmental
3300014295	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1	Environmental
3300014298	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1	Environmental
3300014315	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1	Environmental
3300014316	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1	Environmental
3300014319	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1	Environmental
3300014322	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1	Environmental
3300014864	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D	Environmental
3300014885	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D	Environmental
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental
3300021859	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)	Environmental
3300022204	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1	Environmental
3300022213	Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1	Environmental
3300022214	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1	Environmental
3300022221	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1	Environmental
3300022549	Cold Creek_combined assembly	Environmental
3300023073	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5	Environmental
3300024056	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)	Environmental
3300025106	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes)	Environmental
3300025130	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes)	Environmental
3300025550	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes)	Environmental
3300025555	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 (SPAdes)	Environmental
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025948	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes)	Environmental
3300025968	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes)	Environmental
3300025975	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D2 (SPAdes)	Environmental
3300025980	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes)	Environmental
3300026485	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6	Environmental
3300027683	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental
3300027693	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)	Environmental
3300027715	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)	Environmental
3300027716	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)	Environmental
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental
3300027778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)	Environmental
3300027796	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes)	Environmental
3300027802	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate (SPAdes)	Engineered
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental
3300027841	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)	Environmental
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental
3300027887	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk	Environmental
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental
3300027902	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)	Environmental
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental
3300027972	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)	Environmental
3300028647	Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)	Engineered
3300030606	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125	Environmental
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental
3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Host-Associated
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental
3300031940	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2	Environmental
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental
3300033406	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT	Environmental
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental
3300033434	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b	Environmental
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental
3300033485	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A	Environmental
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental
3300034052	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2	Engineered
3300034054	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.1	Engineered
3300034128	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16	Environmental
3300034148	Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17	Environmental
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental
3300034150	Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17	Environmental
3300034151	Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17	Environmental
3300034169	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15	Environmental
3300034176	Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17	Environmental
3300034194	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17	Environmental
3300034196	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
BS_KBA_SWE12_21mDRAFT_101118022	3300000124	Marine	VSGKQVNDGPTDEQRRGIRRTTILLALVALAIYVAFIASGVIKSQH*
BS_KBA_SWE07_21mDRAFT_10279792	3300000134	Marine	VSGNDVANGPTDQQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH*
JGIcombinedJ13530_1049136552	3300001213	Wetland	VTGTRMSQFTTEQRRRIRWTTILLAATAIGIYVAFIASSVMKAPH*
JGI11641J44799_100358231	3300002961	Wetland	DVNDGPTDEQRRGIRRTAILLALVALAIYVAFIASGVMKAQH*
JGI26145J50221_10225932	3300003371	Arabidopsis Thaliana Rhizosphere	VTGDPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
JGI20214J51088_102717732	3300003432	Wetland	MSDKDVAGGPTDEQRRSIRRTTILLSLVALAIYVAFIASGVIKAQH*
Ga0031656_100122642	3300003858	Freshwater Lake Sediment	VTAAPMNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP*
Ga0031656_100449442	3300003858	Freshwater Lake Sediment	MAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0031656_100930913	3300003858	Freshwater Lake Sediment	KGMALQEMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0031653_100367902	3300003859	Freshwater Lake Sediment	MAERDPTXEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0031654_100099903	3300003861	Freshwater Lake Sediment	MATRMSHGPTEEQRRRIRWTTLVLALTALGIYFAFIASAMMKAPHP*
Ga0055461_101324452	3300003991	Natural And Restored Wetlands	VSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH*
Ga0055494_100793731	3300004048	Natural And Restored Wetlands	VSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH
Ga0055491_101070372	3300004050	Natural And Restored Wetlands	VSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYAAFIASGVMKAQH*
Ga0066602_104154652	3300004151	Freshwater	MALQEMAEREPTAEQRRRIRRSAIVLALIAIAVYVAFIASGVMKAQP*
Ga0066603_104918882	3300004154	Freshwater	MTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSARG*
Ga0066600_102787182	3300004155	Freshwater	MNSQQTDEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQH*
Ga0066600_106792921	3300004155	Freshwater	MNAGPTDEQRRRIRRTTVLLALVALGIYVAFIASSMMKAQP*
Ga0066600_107405111	3300004155	Freshwater	SQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP*
Ga0062589_1000446542	3300004156	Soil	VTGELPDDGRRRRIRRNTVVLALIAIAIYVAFIASGVIKSQP*
Ga0062589_1007242341	3300004156	Soil	GDRTDEQRRRIRRNTLLLTLVALAIYVAFIASSVLHAQA*
Ga0063356_1058298832	3300004463	Arabidopsis Thaliana Rhizosphere	MTQGNQADEQRRRVRRNAILLGLVALGIYVAFIASSVLSAAP*
Ga0069718_100856242	3300004481	Sediment	MALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0062591_1025631262	3300004643	Soil	MTERGPTEEQRRRIRRTAIVLAVVAIGIYVIFIASGVMKAQP*
Ga0062383_101113712	3300004778	Wetland Sediment	MTELDPDAEQRRRIRRTAIVLAAVAIAIYVAFIASGVMKAQP*
Ga0062383_102951061	3300004778	Wetland Sediment	MSNGPTEEQRRRIRWTTILLALTAIGIYVAFIASAMTKAQH*
Ga0062380_102756352	3300004779	Wetland Sediment	MTELDPAAEQRRRIRRTAIVLAAVAIAIYVAFIASGVMKAQP*
Ga0062379_100328972	3300004781	Wetland Sediment	MNSQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP*
Ga0062381_101243312	3300004808	Wetland Sediment	VSDKNVTGGPTDEQRRSIRRTTILLSLVALAIYVAFIASGVMKAQH*
Ga0070676_100878574	3300005328	Miscanthus Rhizosphere	VTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0070670_1020738282	3300005331	Switchgrass Rhizosphere	VTGELPDDGRRRRIRRNTVVLALIALAIYVAFIASGVIKSQP*
Ga0070675_1007733211	3300005354	Miscanthus Rhizosphere	MAERDPTEEQRRRIRRTAIVLAVVAIGIYVIFIASGVMKAQP*
Ga0073905_104258202	3300005655	Activated Sludge	MAERDPTAEQRRRIRRSAIVLALVAIAVYVAFIASGLMKAQP*
Ga0074478_13291183	3300005827	Sediment (Intertidal)	MAQHEPSAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG*
Ga0074479_101899933	3300005829	Sediment (Intertidal)	VSSSEVTSNGPTEEQRRAIRRSTIVLVLVALAIYVAFIASGVIKAQP*
Ga0074472_100783061	3300005833	Sediment (Intertidal)	VSGHDVKDGPTEEQRRGIRRTTILLALVAIAIYVAFIASGVIKAQH*
Ga0074472_108925682	3300005833	Sediment (Intertidal)	VTNGPTDEQKRGIRRTAVLLALVALAIYVAFIASGVMKAQH*
Ga0074470_106656081	3300005836	Sediment (Intertidal)	PHLRRSTRRQVSGIKVSDGPTEEQRRGIRRTTIVLALVALAIYVAFIASSVIRAQH*
Ga0073913_100591322	3300005940	Sand	MNSQQTDAQRRRIRRTAIVLALVALGIYVTFIATGVMKAQP*
Ga0073914_100335373	3300006040	Sand	MNGQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP*
Ga0082021_10044262	3300006092	Wastewater Treatment Plant	MTQDTRDEERRRRDIRRTTVLLVLVALGIYVAFIASGVMQARP*
Ga0082021_11140382	3300006092	Wastewater Treatment Plant	MTNGPTDEQRRRIRWTTFVLALTALGIYVAFIASSVLKAQH*
Ga0082021_117279678	3300006092	Wastewater Treatment Plant	VNDRPANTGPSEQQRRRIRRTTVLLVLVAVGIYVAFIASGIMKAQP*
Ga0079037_1000407362	3300006224	Freshwater Wetlands	VTNGPTDEQKRGIRRTAILLALVALAIYVAFIASGVMKAQH*
Ga0079037_1000420172	3300006224	Freshwater Wetlands	MNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP*
Ga0079037_1001986663	3300006224	Freshwater Wetlands	MAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP*
Ga0079037_1003921772	3300006224	Freshwater Wetlands	MQNGISEEQRRRIRRTTVVLALVALAIYVAFIASGVMKAQP*
Ga0079037_1004372912	3300006224	Freshwater Wetlands	MAERDPTEEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0079037_1007445032	3300006224	Freshwater Wetlands	MDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKAMP*
Ga0079037_1011663052	3300006224	Freshwater Wetlands	MAERDPTAAQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0079037_1012544691	3300006224	Freshwater Wetlands	MNAGPTDEQRRRIRRTTILLALVALGIYVAFIASGVMKAQP*
Ga0079037_1012577662	3300006224	Freshwater Wetlands	MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP*
Ga0079037_1013199982	3300006224	Freshwater Wetlands	MNAGQTDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP*
Ga0079037_1018487192	3300006224	Freshwater Wetlands	MNAGRSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP*
Ga0074062_115816302	3300006606	Soil	MSNGPTEEQRRRIRWTTLLLALTALGIYVAFIASAMLKAQH*
Ga0075428_1000623162	3300006844	Populus Rhizosphere	VTGEPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0075428_1004473362	3300006844	Populus Rhizosphere	VTGDLSEEERRRRIRRSSVILALVALAIYVAFIASGVLKS*
Ga0075421_1003936973	3300006845	Populus Rhizosphere	VTGEPDDDRRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0079303_100273492	3300006930	Deep Subsurface	MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQH*
Ga0079303_104880342	3300006930	Deep Subsurface	GPTDEQRRRIRRTALVLALVALGIYATFIASGVMRAQG*
Ga0105105_102562482	3300009009	Freshwater Sediment	MNQDTQADAQRRRIRRTAVVLALVALAIYVAFIASGVMKAQA*
Ga0105105_104727231	3300009009	Freshwater Sediment	MTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSARA*
Ga0105105_105327592	3300009009	Freshwater Sediment	MAERDPIAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0114973_1000001959	3300009068	Freshwater Lake	VSDEPTPEQRRRIRRTTFLLVLTALGIYVAFIASGVMKANGHG*
Ga0105090_1000052516	3300009075	Freshwater Sediment	MTAGGPSDEQRRRIRRTTIVLVIVALGIYVAFIASGVMKAQP*
Ga0105090_100222802	3300009075	Freshwater Sediment	MAERDPTNEQRRRIRRTAIVLAVVAIGIYVAFIASGVMKAQP*
Ga0105090_100964722	3300009075	Freshwater Sediment	MTEQDPSLAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG*
Ga0105106_106664581	3300009078	Freshwater Sediment	AEREPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQP*
Ga0102851_110677542	3300009091	Freshwater Wetlands	MALQDMAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP*
Ga0102851_129910981	3300009091	Freshwater Wetlands	MNAGRSDEQRRRIRRTTILLVLVALGIYVAFIASGIL
Ga0102851_134113962	3300009091	Freshwater Wetlands	VSTGPTDEQRRRIRRTTFVLALVALGIYVAFIASGVMQARG*
Ga0115026_114054902	3300009111	Wetland	MNAGQTDEQRRRIRRTTILLALVALGIYVAFIASGVMKAQP*
Ga0117941_10819703	3300009120	Lake Sediment	MAQDSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP*
Ga0115027_110600212	3300009131	Wetland	MALQEMAEREPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQS*
Ga0114129_130470802	3300009147	Populus Rhizosphere	VTGTPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0111538_104166592	3300009156	Populus Rhizosphere	VTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGV
Ga0111538_132618062	3300009156	Populus Rhizosphere	TGAPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0105102_101434553	3300009165	Freshwater Sediment	MTEHDPTDAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG*
Ga0113563_100416152	3300009167	Freshwater Wetlands	MNAGPSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP*
Ga0113563_100901014	3300009167	Freshwater Wetlands	VTAAPMNSQQTDAQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP*
Ga0113563_110239902	3300009167	Freshwater Wetlands	MDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKATP*
Ga0113563_131967802	3300009167	Freshwater Wetlands	MNAGPTDEQRRRIRRTTILLALVAIGIYVAFIASGVMKAQP*
Ga0105097_102486102	3300009169	Freshwater Sediment	MAERDPTAAQCGRIRRSAIVLAVVAIAIYAAFIASGVMKAQP*
Ga0114939_1000042632	3300009455	Groundwater	MTEPTAEQRRRVRRSAIMLAVVAIAIYVAFIASGVFGARG*
Ga0114939_100078998	3300009455	Groundwater	MQNGTSEEQRRRIRRTTVVLALVAVAIYVAFIASGVMKAQP*
Ga0114939_100404853	3300009455	Groundwater	VSEGRASTGTTAEQRRRIRRTTILLVLIALGIYVAFIASGVMKAQP*
Ga0118657_100049615	3300009506	Mangrove Sediment	VSNVDSRPGDEQQRRRIRRTAILLALTALGIYVAFIASGIMKATP*
Ga0118657_100640307	3300009506	Mangrove Sediment	VSDRPLNAGPSEEQRRRIRRMTIVLVLVALAIYVAFIASGVMQARS*
Ga0118657_113665402	3300009506	Mangrove Sediment	LNAGPTGEQRRRIRRTTIVLALVAIAIYVTFIASGVLGRYG*
Ga0123573_101775952	3300009509	Mangrove Sediment	MRTGPDEQQRRRIRRSTIVLALVALGIYVAFIASGVMQARG*
Ga0123573_103392582	3300009509	Mangrove Sediment	VSGVDSRPGDEQQRRRIRRTAILLALTALGIYVAFIASGIMKATP*
Ga0114942_11609112	3300009527	Groundwater	VPALNDMAEHDPTNEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0073899_111279262	3300009540	Activated Sludge	AEQRRRIRRSAIVLAVVAIAIYAAFIASGVMKAQP*
Ga0105347_12634562	3300009609	Soil	VTGELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP*
Ga0105340_12133912	3300009610	Soil	VTGERPTEQRRRIRRNTLLLALTAVAIYVAFIVSGVIKAQP*
Ga0116141_104526882	3300009693	Anaerobic Digestor Sludge	MTNGPTEEQRRRIRWTTFVLALTALGIYVAFIASSVLKAQP*
Ga0130016_102190002	3300009868	Wastewater	MNAGPTDEQRRRIRRTTIVLVLVALGIYVAFIASGMMGARS*
Ga0130016_105660502	3300009868	Wastewater	MNAGPTDEQRRRIRRTTIVLVLVALGIYVAFIASSIMGARS*
Ga0131092_101010962	3300009870	Activated Sludge	VDNGPNEQQRRGIRRTTILLALVALAIYVAFIASGVIKSQH*
Ga0131092_107132612	3300009870	Activated Sludge	MSNGPTDQQRRRIRWTTILLVATALGIYVAFIASSVMKAQH*
Ga0131092_108984321	3300009870	Activated Sludge	MDTRMSNGPTDEQRRRIRWTTFLLVVTALGIYVAFIVSSVM
Ga0134122_102745992	3300010400	Terrestrial Soil	VTGELPDDGRRRRIRRSSVVLALIALAIYVAFIASGVIKSQT*
Ga0136852_100061542	3300010412	Mangrove Sediment	MDRGPSDDERRRIRRMAILLALTALGIYVAFIASGIMKAQP*
Ga0139324_10041832	3300010997	Sediment	MDRGPGDDERRRIRRTAILLALTALGIYVAFIASGIMKAQP*
Ga0159060_11430962	3300012990	Hydrocarbon Resource Environments	MAQDKDEQRRRIRRTAILLVVVALGIYVAFIASSVMSVQP*
Ga0119887_10016607	3300013769	Sewage Treatment Plant	VSGIKVSDGPTEEQRRGIRRTTIVLALVALAIYVAFIASSVIKAQH*
Ga0119887_100221010	3300013769	Sewage Treatment Plant	VSAPQGHGPTEQQRRAIRRNTILLSLVAFAIYVAFIASGVIKAQP*
Ga0075307_10023272	3300014260	Natural And Restored Wetlands	VRANKVSDGPTEEQRRGIRRTTILLALVALAIYVAFIASGVIKAQH*
Ga0075305_11414522	3300014295	Natural And Restored Wetlands	VSAHKVSDGPTEEQRRGIRRTTILLALVALAIYVAFIASGVIKAQH*
Ga0075341_10091772	3300014298	Natural And Restored Wetlands	VSDKQRNDGPTEEQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH*
Ga0075350_10616232	3300014315	Natural And Restored Wetlands	VSDRQVNDGPTEEQRRGIRRTTIVLVLVALAIYVAFIASGVLKSQH*
Ga0075339_10080812	3300014316	Natural And Restored Wetlands	MNSQQTEEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQP*
Ga0075348_12207201	3300014319	Natural And Restored Wetlands	VSDRQVNDGPTEEQRRGIRRTTIVLVLVALAIYVAFIASGVLKSQH
Ga0075355_11727092	3300014322	Natural And Restored Wetlands	MNGPNDEQRRGIRRTTILLVLVTLAIYFAFIASGVIKAQH*
Ga0180068_10527432	3300014864	Soil	VTGELPDDERRRRIRRNTVVLALIVLAIYVAFIASGVIKSQP*
Ga0180063_10259431	3300014885	Soil	QHDDQRRRIRRNTILLVLVALGIYVAFIASSVIGAQH*
Ga0163161_121026812	3300017792	Switchgrass Rhizosphere	VTGDPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP
Ga0190266_101177732	3300017965	Soil	VTGELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP
Ga0187787_103452082	3300018029	Tropical Peatland	SHLTPEQRRGIRRTTILLALVALAIYVAFIASGVIKSQH
Ga0184628_103209562	3300018083	Groundwater Sediment	MSNGPTVEQRRRIRWTTLLLALTALGIYVAFIASAMLKAQR
Ga0184628_106562681	3300018083	Groundwater Sediment	SDAQRRRNIRRNALVLALVALGIYVWFIASSVLSARP
Ga0190265_109235132	3300018422	Soil	VTGEPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP
Ga0190272_102228922	3300018429	Soil	VTSERPTVQRRRIRRNALLLALTALAIYVAFIVSGVIKAQP
Ga0190270_113565082	3300018469	Soil	VTGELPDDERRRRIRRNTVVLALIVLAIYVAFIASGVIKSQP
Ga0190274_103338493	3300018476	Soil	MAERDPTEEQRRRIRRTAIVLALVAIGIYVIFIASGVMKAQP
Ga0190271_113387422	3300018481	Soil	MSGELSADERRRRIRRNTLVLALTALAIYVAFIVSGVIKAQS
Ga0210334_102524262	3300021859	Estuarine	MAQHEPSAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG
Ga0224496_100803112	3300022204	Sediment	MAMAQHEPTAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG
Ga0224500_1000091618	3300022213	Sediment	MTELDLAAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMNAQP
Ga0224500_100973371	3300022213	Sediment	EFDPAAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMNAQP
Ga0224500_101039572	3300022213	Sediment	MAEPTAEQRRRVRRSAIVLAVVALAIYVAFIASGVLGARG
Ga0224505_1000030418	3300022214	Sediment	MTEFDPAAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMNAQP
Ga0224505_100281781	3300022214	Sediment	SSKDAALQQMAERDPTAEQRRRIRRSAIVLAVVAIAIYAAFIASGVMKAQP
Ga0224506_102184773	3300022221	Sediment	GPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARQ
Ga0212091_101673592	3300022549	Groundwater	MAKRESSAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0247744_10128133	3300023073	Soil	VTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP
Ga0124853_10109512	3300024056	Freshwater Wetlands	MTNGPTEQQRRRIRWTTVLLVLTALGIYVAFIASSVLKAQH
Ga0124853_14397503	3300024056	Freshwater Wetlands	MNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP
Ga0124853_14556442	3300024056	Freshwater Wetlands	MAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP
Ga0209398_10028123	3300025106	Groundwater	VSEGRASTGTTAEQRRRIRRTTILLVLVALGIYVAFIASGVMKAQP
Ga0209594_100137112	3300025130	Groundwater	MQNGTSEEQRRRIRRTTVVLALVAVAIYVAFIASGVMKAQP
Ga0209594_10043852	3300025130	Groundwater	MTEPTAEQRRRVRRSAIMLAVVAIAIYVAFIASGVFGARG
Ga0210098_10415252	3300025550	Natural And Restored Wetlands	VSANKVSDGPTEEQRRGIRRTTILLALVALAIYVAFIASGVIKAQH
Ga0210121_10032963	3300025555	Natural And Restored Wetlands	VNDGPTAEQRRGIRRTTIVLALVALAIYVAFIASGVIKSQH
Ga0207643_104794982	3300025908	Miscanthus Rhizosphere	VTGELPDDGRRRRIRRNTVVLALIALAIYVAFIASGVIKSQP
Ga0207650_113373152	3300025925	Switchgrass Rhizosphere	VTGELPDDGRRRRIRRNTVVLALIALAIYVAFIASGVIKSRP
Ga0210088_10196522	3300025948	Natural And Restored Wetlands	MDSQQTEEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQP
Ga0210103_10095322	3300025968	Natural And Restored Wetlands	VSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYAAFIASGVMKAQH
Ga0210091_10135742	3300025975	Natural And Restored Wetlands	MSDKDVAGGPTDEQRRSIRRTTILLSLVALAIYVAFIASGVIKAQH
Ga0210137_10459161	3300025980	Natural And Restored Wetlands	MSDKDVAGGPTDEQRRSIRRTTILLSLVALAIYVAFIASG
Ga0256805_10155232	3300026485	Sediment	VRGGAGTVEEGPNQEQRRGIRRTTLLLALVALAIYVAFIASGVIKSQH
Ga0209392_10047812	3300027683	Freshwater Sediment	MTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSVRG
Ga0209392_10657402	3300027683	Freshwater Sediment	MAERDPTNEQRRRIRRTAIVLAVVAIGIYVAFIASGVMKAQP
Ga0209392_10882442	3300027683	Freshwater Sediment	MTAGGPSDEQRRRIRRTTIVLVIVALGIYVAFIASGVMKAQP
Ga0209704_11175332	3300027693	Freshwater Sediment	MTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSARG
Ga0208665_100069923	3300027715	Deep Subsurface	MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209682_100063013	3300027716	Wetland Sediment	MNSQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209492_13082822	3300027721	Freshwater Sediment	MAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209464_100836623	3300027778	Wetland Sediment	VSDKNVTGGPTDEQRRSIRRTTILLALVALAIYVAFIASGVMKAQH
Ga0209464_102535622	3300027778	Wetland Sediment	MSNGPTEEQRRRIRWTTILLALTAIGIYVAFIASAMTKAQH
Ga0209464_103806582	3300027778	Wetland Sediment	DEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209373_103144682	3300027796	Freshwater	MAQGSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP
Ga0209476_103310471	3300027802	Activated Sludge	MAERDPTAEQRRRIRRSAIVLALVAIAVYVAFIASGL
Ga0209797_100374453	3300027831	Wetland Sediment	MTELDPAAEQRRRIRRTAIVLAAVAIAIYVAFIASGVMKAQP
Ga0209262_100214881	3300027841	Freshwater	PTDEQRRRIRRTALVLALVALGIYVAFIASGVMRAQG
Ga0209262_101101062	3300027841	Freshwater	MALQEMAEREPTAEQRRRIRRSAIVLALIAIAVYVAFIASGVMKAQP
Ga0209262_101792172	3300027841	Freshwater	MNSQQTDEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQH
Ga0209262_102086642	3300027841	Freshwater	MSSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP
Ga0209262_104586041	3300027841	Freshwater	DPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209397_106373861	3300027871	Wetland	TGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209293_103648972	3300027877	Wetland	MNAGRSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP
Ga0209450_100200317	3300027885	Freshwater Lake Sediment	MTGGPTSEQRRRIRWTTVLLVLTALGIYVAFIASSVLKAQH
Ga0209450_100407175	3300027885	Freshwater Lake Sediment	MAQDSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP
Ga0209450_101139711	3300027885	Freshwater Lake Sediment	ALNEMAERDPTEEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209450_102857123	3300027885	Freshwater Lake Sediment	ERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209450_104713162	3300027885	Freshwater Lake Sediment	MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQH
Ga0208980_100055952	3300027887	Wetland	VNDGPTDEQRRGIRRTAILLALVALAIYVAFIASGVMKAQH
Ga0209496_101449691	3300027890	Wetland	GPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQH
Ga0209496_103333982	3300027890	Wetland	MALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQS
Ga0209254_102306312	3300027897	Freshwater Lake Sediment	MNGQQTEEQRRRIRRTTIVLALVALGIYMAFIASGVMKAQP
Ga0209668_100877572	3300027899	Freshwater Lake Sediment	MNPGPTSEQRRRIRWTTVVLALIAIGIYVAFIASSVIKARH
Ga0209668_101319512	3300027899	Freshwater Lake Sediment	MAERDPTEEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209668_101341743	3300027899	Freshwater Lake Sediment	VSGSEVTSNGPTEEQRRAIRRSTIVLVLVALVIYVAFIASGVMKAQP
Ga0209668_101595492	3300027899	Freshwater Lake Sediment	MTGARMTNGPTEQQRRRIRWTTVLLVLTALGIYVAFIASSVLKAQH
Ga0209668_102197302	3300027899	Freshwater Lake Sediment	MAERDQTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209668_102226233	3300027899	Freshwater Lake Sediment	VNDGPTDKQRRAIRRTAILLALVALAIYVAFIASGVMKAQH
Ga0209668_103536462	3300027899	Freshwater Lake Sediment	MGSQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209668_104195232	3300027899	Freshwater Lake Sediment	MAERDPTAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209253_1000774713	3300027900	Freshwater Lake Sediment	MATRMSNGPTEQQRRRIRWTTIVLALTAIGIYVAFIASAMMKSQH
Ga0209253_103763193	3300027900	Freshwater Lake Sediment	MSQGRTVEQRRRIRWTTVLLVLTALGIYVAFIASSVLKAPH
Ga0209253_106232412	3300027900	Freshwater Lake Sediment	MAQGTQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP
Ga0209253_108765541	3300027900	Freshwater Lake Sediment	QTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209048_100100365	3300027902	Freshwater Lake Sediment	MRSGPTDEQRRRIRWTTVLLALAALGIYVAFIASSVMKARH
Ga0209048_100730573	3300027902	Freshwater Lake Sediment	MSHGPTEEQRRRIRWTTLVLALTALGIYFAFIASAMMKAPHP
Ga0209382_100921272	3300027909	Populus Rhizosphere	VTGDLSEEERRRRIRRSSVILALVALAIYVAFIASGVLKS
Ga0209536_1010175762	3300027917	Marine Sediment	MSSGPTDEQRRRIRRNSIVLALTALAIYVTFIVSGMLRVPN
Ga0209079_100058566	3300027972	Freshwater Sediment	MTEQDPSLAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG
Ga0209079_101947382	3300027972	Freshwater Sediment	MTEHDPTDAQRRRIRRTAFLLAAVALAIYVAFIASGVMKAQG
Ga0272412_10824571	3300028647	Activated Sludge	MTQDTRDEERRRRDIRRTTVLLVLVALGIYVAFIASGVMQARP
Ga0299906_100339763	3300030606	Soil	VIGGRPTEQRRRIRRNTLLLALTALAIYVAFIVSGVIKAQP
Ga0268386_100000265	3300030619	Soil	VTGELPEDERRRRIRRNTVVLALIAIAIYVAFIASGVIKSQA
Ga0316575_100539153	3300031665	Rhizosphere	MSRGPGDDERRRIRRTAILLALTALGIYVAFIASGIMKAQP
Ga0315288_103488763	3300031772	Sediment	MAERGPTAEQRRRIRRSAIVLAVVAITIYVAFIASGVMKAQP
Ga0315290_100993833	3300031834	Sediment	MAERDPTAEQRRRIRRSAIVLAVVAIGIYVAFIASGVMKAQP
Ga0315290_102232422	3300031834	Sediment	VSGNDVSNGPTDEQKRGIRRTTILLALVALAIYVAFIASGVMKARH
Ga0315290_102458912	3300031834	Sediment	MAQDSQTAEQRRRIRRAAILLGVVALAIYVAFIASGVMKAQP
Ga0315290_103413133	3300031834	Sediment	MSNGPTEQQRRRIRWTTILLALTAIGIYVAFIASAMMKSQH
Ga0315290_103418871	3300031834	Sediment	MNLGPTSEQRRRIRWTTVVLALIAIGIYVAFIASSVIKARP
Ga0315909_109423722	3300031857	Freshwater	VTAAPMNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP
Ga0315297_100086872	3300031873	Sediment	MSQGPTAEQRRRIRRTTVLLALTALGIYVAFIASSVLKAPH
Ga0315297_104330452	3300031873	Sediment	VSGNDVTNGPTDQQKRGIRRTTILLALVALAIYVAFIASGVMKAQH
Ga0315297_106134312	3300031873	Sediment	MNTGLTDEQRRRIRRTAILLALVALGIYAAFIASGVIKAQH
Ga0310901_100019795	3300031940	Soil	VTGDPNDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP
Ga0315278_106143242	3300031997	Sediment	MAERGPTAEQRRRIRRSAIVLAVVAITIYVAFIASGVMSAQP
Ga0315905_111788982	3300032092	Freshwater	MAQHEPTAEQRRRVRRSAIVLAVVAIAIYAAFIASGVLGARG
Ga0315292_107630872	3300032143	Sediment	VTAAPMNRQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315295_116150752	3300032156	Sediment	MSNGPTEQQRRRIRWTTIVLALTAIGIYVAFIASAMMKSQH
Ga0315283_118786922	3300032164	Sediment	MNSQQTDAQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315276_111208463	3300032177	Sediment	NDVTNGPTDQQKRGIRRTTILLALVALAIYVAFIASGVMKAQH
Ga0307471_1038767792	3300032180	Hardwood Forest Soil	VSDDASSERRRRIRRNSVVLALVAAAIYVGFIVSGVIRAQH
Ga0315271_106477282	3300032256	Sediment	MNPGPTSEQRRRIRWSAIVLALIAIGIYVAFIASSVIKARH
Ga0315271_109010722	3300032256	Sediment	MSNGPTDEQRRRIRWTTLVLALVALGIYVAFIASAMMKAQP
Ga0315271_115262022	3300032256	Sediment	QVTAAPMNSQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315286_117202652	3300032342	Sediment	VTAAPMNSQQTDEQRRRIRRTTIVLALVALGIYAAFIASGVMKAQP
Ga0315287_1000367111	3300032397	Sediment	MNSQQTEERRRRIRRTTIVLALVALGIYAAFIASGVMKAQP
Ga0315287_105011792	3300032397	Sediment	MNPGPTSEQRRRIRWTAVVLALIAIGIYVAFIASSVIKARH
Ga0315287_110799682	3300032397	Sediment	MNGQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315287_110878662	3300032397	Sediment	MSSQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315287_124631472	3300032397	Sediment	VSVSEVTRNGPTEEQRRAIRRSTIVLVLVALAIYVAFIASGVMKAQP
Ga0335084_115176552	3300033004	Soil	VRGGAGTVDQGPNQEQRRGIRRTTLLLALVALAIYVAFIASGVIKSQH
Ga0316604_105127132	3300033406	Soil	MDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKAMP
Ga0316604_107989132	3300033406	Soil	MNAGQTDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP
Ga0316604_108373851	3300033406	Soil	SKGMALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0316605_106669202	3300033408	Soil	VSGEHVNQGPTDRQRRRIRRTTILLALVALGIYVAFIASGVMKAQP
Ga0316605_114260132	3300033408	Soil	MQNGISEEQRRRIRRTTVVLALVALAIYVAFIASGVMKAQP
Ga0316605_114346691	3300033408	Soil	NGISEEQRRRIRRTTVVLALVALAIYVAFIASGVMKAQP
Ga0316605_114969312	3300033408	Soil	MALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0316605_121518182	3300033408	Soil	MNQGGPLDEQRRRNVRWTAIVLALIALGIYVAFIASSVMKAQH
Ga0316605_123491651	3300033408	Soil	MALQEMAEREPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQS
Ga0316605_124337852	3300033408	Soil	VPASNDMAEHEPTSEQRRRIRRTAIVLAVVAIAIYVAFIASGVMKAQP
Ga0316603_104216793	3300033413	Soil	MALQEMAEREPTAEQRRRIRRSAIVLALVVIAVYVAFIASGVMKAQS
Ga0316603_105829563	3300033413	Soil	PGPTDRQRRRIRRTTILLALVALGIYVAFIASGVMKAQP
Ga0316603_107188492	3300033413	Soil	MNAGPSDEQRRRIRRTTVVLVLVALGIYVAFIASSMMKAQP
Ga0316603_122559871	3300033413	Soil	EHEPTSEQRRRIRRTAIVLAVVAIAIYVAFIASGVMKAQP
Ga0316619_105847642	3300033414	Soil	MNAGPTDEQRRRIRRTTILLALVALGIYVAFIASGVMKAQP
Ga0316619_106121822	3300033414	Soil	VSGKQVNDGPTDEQRRGIRRTTIVLALVALAIYVAFIASGVIKSQH
Ga0316625_1003964612	3300033418	Soil	VSAKPVNEGQSEQQRRAIRRTTILLVLVALGIYVAFIASGVIKAQH
Ga0316625_1014264212	3300033418	Soil	VSAPEGHGPTEQQRRAIRRNTILLSLVALAIYVAFIASGVIKAQP
Ga0316625_1024365201	3300033418	Soil	MDSQQTEQQRRRIRRTTIALALVALGIYVAFIASGMMKAMS
Ga0316601_1005995742	3300033419	Soil	MNAGPSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP
Ga0316601_1011564882	3300033419	Soil	MALQEMAEREPTAEQRRRIRRSAIVLALIAIAVYVAFIASGVMKAQS
Ga0316613_101089751	3300033434	Soil	PTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQS
Ga0316627_1001276421	3300033482	Soil	GRQVRNRAMNAGPSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP
Ga0316627_1005285692	3300033482	Soil	VSGGHVNTGPTDEQRRRIRRTTIVLALVALGIYVAFIVSGVMKAQP
Ga0316629_113163731	3300033483	Soil	NPGPTDRQRRRIRRTTILLALVALGIYVAFIASGVMKAQP
Ga0316626_102326732	3300033485	Soil	MDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKATP
Ga0316626_103703631	3300033485	Soil	PALQDMAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP
Ga0316630_100212771	3300033487	Soil	MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQ
Ga0373889_010515_158_280	3300034052	Sediment Slurry	MTEPTAEQRRRVRRSAIVLGVVAIAIYVAFIMSGVLGARG
Ga0373889_021643_621_749	3300034052	Sediment Slurry	MTEHDPIEAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG
Ga0373891_033730_486_614	3300034054	Sediment Slurry	MAEHDTTEEQRRRIRRSALVLAVVAIAIYVAFIASGVMKAQP
Ga0370490_0022335_401_529	3300034128	Untreated Peat Soil	MAERDPTNEQRRRIRRSAIVLAVVAIAIYAAFIASGVMKAQP
Ga0364927_0116407_169_297	3300034148	Sediment	VTRELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP
Ga0364929_0261250_26_154	3300034149	Sediment	VTGELPDDERRRRIRRNTMVLALIALAIYVAFIASGVIKSQP
Ga0364929_0267749_474_578	3300034149	Sediment	VTGELPDDERRRRIRRNTMVLALIALAIYVAFIAS
Ga0364933_168268_391_519	3300034150	Sediment	VTGELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSHT
Ga0364935_0017066_93_221	3300034151	Sediment	VTGELPDVERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP
Ga0370480_0004625_4048_4176	3300034169	Untreated Peat Soil	MAERDPTSEQRRRIRRSAIVLAVIAVAIYAAFIASGVMKAQP
Ga0364931_0014685_1359_1484	3300034176	Sediment	VTGERPTEQRRRIRRNTLLLALTALAIYVAFIVSGVIKAQP
Ga0370499_0203000_48_173	3300034194	Untreated Peat Soil	VTTGPTDEQRRRIRRTTVVLALVALGIYVAFIASGVMQARG
Ga0370503_0229346_161_289	3300034196	Untreated Peat Soil	MADRDPSAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKSQP