Metagenome / Metatranscriptome Family F012904

Basic Information
Family ID	F012904
Family Type	Metagenome / Metatranscriptome
Number of Sequences	276
Average Sequence Length	37 residues
Representative Sequence	MTPEREQRRNNRRTALVLGSIALAFFVGIMLKYVMLK
Number of Associated Samples	186
Number of Associated Scaffolds	276

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	90.58 %
% of genes near scaffold ends (potentially truncated)	10.87 %
% of genes from short scaffolds (< 2000 bps)	76.45 %
Associated GOLD sequencing projects	172
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Bacteria (92.029 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.420 % of family members)
Environment Ontology (ENVO)	Unclassified (43.841 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (36.594 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 276 Family Scaffolds
PF04442	CtaG_Cox11	39.13
PF00115	COX1	37.68
PF11174	DUF2970	5.80
PF00510	COX3	5.80
PF11137	DUF2909	2.54
PF08241	Methyltransf_11	1.45
PF13442	Cytochrome_CBB3	1.09
PF07479	NAD_Gly3P_dh_C	1.09
PF02104	SURF1	1.09
PF13432	TPR_16	0.36
PF10003	DUF2244	0.36
PF02630	SCO1-SenC	0.36
PF12762	DDE_Tnp_IS1595	0.36
PF00950	ABC-3	0.36
PF06969	HemN_C	0.36
PF00156	Pribosyltran	0.36
PF01467	CTP_transf_like	0.36

COG ID	Name	Functional Category	% Frequency in 276 Family Scaffolds
COG3175	Cytochrome c oxidase assembly protein Cox11	Posttranslational modification, protein turnover, chaperones [O]	39.13
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	5.80
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	1.09
COG3346	Cytochrome oxidase assembly protein ShyY1	Posttranslational modification, protein turnover, chaperones [O]	1.09
COG0609	ABC-type Fe3+-siderophore transport system, permease component	Inorganic ion transport and metabolism [P]	0.36
COG0635	Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductase	Coenzyme transport and metabolism [H]	0.36
COG1108	ABC-type Mn2+/Zn2+ transport system, permease component	Inorganic ion transport and metabolism [P]	0.36
COG1225	Peroxiredoxin	Posttranslational modification, protein turnover, chaperones [O]	0.36
COG1999	Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family	Posttranslational modification, protein turnover, chaperones [O]	0.36
COG4606	ABC-type enterochelin transport system, permease component	Inorganic ion transport and metabolism [P]	0.36

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.01 %
Unclassified	root	N/A	3.99 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.01 %
Unclassified	root	N/A	3.99 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.03 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	3.99 %
Unclassified	root	N/A	3.99 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	89.86 %
Unclassified	root	N/A	3.99 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	2.90 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.36 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.72 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	72.83 %
Unclassified	root	N/A	3.99 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2.90 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.36 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.72 %

Name	Rank	Taxonomy	Distribution
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	14.86 %
Unclassified	root	N/A	3.99 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	2.90 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	0.36 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.72 %

Name	Rank	Taxonomy	Distribution
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	9.78 %
Unclassified	root	N/A	3.99 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2.90 %
Thermomicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	2.90 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Tylenchina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Panagrolaimomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Strongyloidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Steinernematidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Steinernema	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Steinernema glaseri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Steinernema glaseri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Steinernema glaseri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Steinernema glaseri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Steinernema glaseri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Steinernema glaseri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	3.99 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	2.90 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.36 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.36 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.36 %
Steinernema glaseri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	0.72 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2032320006\|FACEOR_FYWIORV02GB111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	515	Open in IMG/M
3300002558\|JGI25385J37094_10157811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	608	Open in IMG/M
3300005174\|Ga0066680_10132037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1552	Open in IMG/M
3300005181\|Ga0066678_10394916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	917	Open in IMG/M
3300005447\|Ga0066689_11030583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	506	Open in IMG/M
3300005526\|Ga0073909_10000275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	18060	Open in IMG/M
3300005526\|Ga0073909_10574079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	554	Open in IMG/M
3300005540\|Ga0066697_10260795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	1026	Open in IMG/M
3300005542\|Ga0070732_10000792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	18342	Open in IMG/M
3300005552\|Ga0066701_10011700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	4045	Open in IMG/M
3300005552\|Ga0066701_10729774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	594	Open in IMG/M
3300005555\|Ga0066692_10899835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	542	Open in IMG/M
3300005558\|Ga0066698_10430863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	903	Open in IMG/M
3300005560\|Ga0066670_10014763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3467	Open in IMG/M
3300005568\|Ga0066703_10228742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1130	Open in IMG/M
3300005576\|Ga0066708_10563430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	733	Open in IMG/M
3300005713\|Ga0066905_100806014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	815	Open in IMG/M
3300005764\|Ga0066903_100566067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1955	Open in IMG/M
3300005764\|Ga0066903_103985167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	792	Open in IMG/M
3300005764\|Ga0066903_104320056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	759	Open in IMG/M
3300005829\|Ga0074479_10457997	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	609	Open in IMG/M
3300005829\|Ga0074479_10696890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3799	Open in IMG/M
3300005829\|Ga0074479_11152839	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	799	Open in IMG/M
3300005830\|Ga0074473_10732025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	2013	Open in IMG/M
3300005833\|Ga0074472_10210507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	4286	Open in IMG/M
3300005836\|Ga0074470_10266397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4870	Open in IMG/M
3300005875\|Ga0075293_1004384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	1398	Open in IMG/M
3300006031\|Ga0066651_10347656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	795	Open in IMG/M
3300006032\|Ga0066696_10073838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1983	Open in IMG/M
3300006034\|Ga0066656_10136417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1523	Open in IMG/M
3300006034\|Ga0066656_10877122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	575	Open in IMG/M
3300006050\|Ga0075028_100104406	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1450	Open in IMG/M
3300006050\|Ga0075028_100670282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	622	Open in IMG/M
3300006173\|Ga0070716_100009457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	4860	Open in IMG/M
3300006173\|Ga0070716_100222991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1268	Open in IMG/M
3300006755\|Ga0079222_10031622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2266	Open in IMG/M
3300006755\|Ga0079222_11487942	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	633	Open in IMG/M
3300006796\|Ga0066665_11068852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	616	Open in IMG/M
3300006797\|Ga0066659_10169081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1572	Open in IMG/M
3300006852\|Ga0075433_10206204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1748	Open in IMG/M
3300006903\|Ga0075426_10094926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2137	Open in IMG/M
3300006903\|Ga0075426_10407282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1004	Open in IMG/M
3300007255\|Ga0099791_10137348	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1138	Open in IMG/M
3300007255\|Ga0099791_10298542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	768	Open in IMG/M
3300007255\|Ga0099791_10449479	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	623	Open in IMG/M
3300007258\|Ga0099793_10463169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	628	Open in IMG/M
3300007265\|Ga0099794_10318186	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	807	Open in IMG/M
3300007265\|Ga0099794_10423681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	696	Open in IMG/M
3300007265\|Ga0099794_10483830	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300007788\|Ga0099795_10011555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2644	Open in IMG/M
3300007788\|Ga0099795_10328646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	679	Open in IMG/M
3300009038\|Ga0099829_10103770	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2216	Open in IMG/M
3300009038\|Ga0099829_10295594	Not Available	1327	Open in IMG/M
3300009038\|Ga0099829_10629130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	892	Open in IMG/M
3300009038\|Ga0099829_10767843	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	801	Open in IMG/M
3300009088\|Ga0099830_10355721	Not Available	1178	Open in IMG/M
3300009089\|Ga0099828_11864305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	528	Open in IMG/M
3300009090\|Ga0099827_10407972	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1162	Open in IMG/M
3300009090\|Ga0099827_10502807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1041	Open in IMG/M
3300009090\|Ga0099827_10703937	Not Available	873	Open in IMG/M
3300009090\|Ga0099827_11283198	All Organisms → cellular organisms → Bacteria → Proteobacteria	637	Open in IMG/M
3300009090\|Ga0099827_11405345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	607	Open in IMG/M
3300009090\|Ga0099827_11558154	All Organisms → cellular organisms → Bacteria → Proteobacteria	575	Open in IMG/M
3300009137\|Ga0066709_100908641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1284	Open in IMG/M
3300009597\|Ga0105259_1079885	All Organisms → cellular organisms → Bacteria → Proteobacteria	757	Open in IMG/M
3300009678\|Ga0105252_10000039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	117511	Open in IMG/M
3300010046\|Ga0126384_12007711	All Organisms → cellular organisms → Bacteria → Proteobacteria	553	Open in IMG/M
3300010047\|Ga0126382_11219857	All Organisms → cellular organisms → Bacteria → Proteobacteria	675	Open in IMG/M
3300010047\|Ga0126382_11637680	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	598	Open in IMG/M
3300010159\|Ga0099796_10036136	All Organisms → cellular organisms → Bacteria → Proteobacteria	1643	Open in IMG/M
3300010301\|Ga0134070_10430300	All Organisms → cellular organisms → Bacteria → Proteobacteria	525	Open in IMG/M
3300010301\|Ga0134070_10468232	All Organisms → cellular organisms → Bacteria → Proteobacteria	507	Open in IMG/M
3300010323\|Ga0134086_10250821	All Organisms → cellular organisms → Bacteria → Proteobacteria	674	Open in IMG/M
3300010325\|Ga0134064_10396803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	550	Open in IMG/M
3300010358\|Ga0126370_10403275	All Organisms → cellular organisms → Bacteria → Proteobacteria	1124	Open in IMG/M
3300010358\|Ga0126370_12180561	All Organisms → cellular organisms → Bacteria → Proteobacteria	546	Open in IMG/M
3300010359\|Ga0126376_10108227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2137	Open in IMG/M
3300010359\|Ga0126376_10242900	Not Available	1526	Open in IMG/M
3300010359\|Ga0126376_10298929	All Organisms → cellular organisms → Bacteria → Proteobacteria	1399	Open in IMG/M
3300010359\|Ga0126376_11285345	All Organisms → cellular organisms → Bacteria → Proteobacteria	751	Open in IMG/M
3300010359\|Ga0126376_12446153	All Organisms → cellular organisms → Bacteria → Proteobacteria	569	Open in IMG/M
3300010361\|Ga0126378_11069072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	909	Open in IMG/M
3300010361\|Ga0126378_13460171	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	501	Open in IMG/M
3300010362\|Ga0126377_10876208	All Organisms → cellular organisms → Bacteria → Proteobacteria	960	Open in IMG/M
3300010362\|Ga0126377_11085512	All Organisms → cellular organisms → Bacteria → Proteobacteria	869	Open in IMG/M
3300010366\|Ga0126379_11771558	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	722	Open in IMG/M
3300010366\|Ga0126379_12086927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	669	Open in IMG/M
3300010376\|Ga0126381_102843799	All Organisms → cellular organisms → Bacteria → Proteobacteria	690	Open in IMG/M
3300010398\|Ga0126383_10124248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2358	Open in IMG/M
3300011269\|Ga0137392_10184378	All Organisms → cellular organisms → Bacteria → Proteobacteria	1701	Open in IMG/M
3300011270\|Ga0137391_11168299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	617	Open in IMG/M
3300011410\|Ga0137440_1040343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	872	Open in IMG/M
3300011430\|Ga0137423_1080078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	970	Open in IMG/M
3300011433\|Ga0137443_1006577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2684	Open in IMG/M
3300011438\|Ga0137451_1026776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1668	Open in IMG/M
3300011441\|Ga0137452_1009055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	3030	Open in IMG/M
3300011442\|Ga0137437_1003828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5330	Open in IMG/M
3300011442\|Ga0137437_1209662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	676	Open in IMG/M
3300011444\|Ga0137463_1000114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	31657	Open in IMG/M
3300011444\|Ga0137463_1001760	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	7174	Open in IMG/M
3300011444\|Ga0137463_1118282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	997	Open in IMG/M
3300012096\|Ga0137389_10994090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	719	Open in IMG/M
3300012189\|Ga0137388_10404744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1264	Open in IMG/M
3300012189\|Ga0137388_10870658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	834	Open in IMG/M
3300012198\|Ga0137364_10310020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1173	Open in IMG/M
3300012199\|Ga0137383_10292528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1193	Open in IMG/M
3300012199\|Ga0137383_10848668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	667	Open in IMG/M
3300012200\|Ga0137382_10018000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3981	Open in IMG/M
3300012201\|Ga0137365_10622186	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	791	Open in IMG/M
3300012201\|Ga0137365_11093901	All Organisms → cellular organisms → Bacteria → Proteobacteria	574	Open in IMG/M
3300012202\|Ga0137363_10502926	All Organisms → cellular organisms → Bacteria → Proteobacteria	1018	Open in IMG/M
3300012202\|Ga0137363_11822858	All Organisms → cellular organisms → Bacteria → Proteobacteria	501	Open in IMG/M
3300012203\|Ga0137399_10270205	All Organisms → cellular organisms → Bacteria → Proteobacteria	1398	Open in IMG/M
3300012203\|Ga0137399_10519243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	999	Open in IMG/M
3300012203\|Ga0137399_10883871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	752	Open in IMG/M
3300012203\|Ga0137399_11123703	All Organisms → cellular organisms → Bacteria → Proteobacteria	661	Open in IMG/M
3300012204\|Ga0137374_10064794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3642	Open in IMG/M
3300012204\|Ga0137374_10211333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1661	Open in IMG/M
3300012206\|Ga0137380_10056503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3595	Open in IMG/M
3300012206\|Ga0137380_10326191	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1372	Open in IMG/M
3300012206\|Ga0137380_11622360	All Organisms → cellular organisms → Bacteria → Proteobacteria	531	Open in IMG/M
3300012207\|Ga0137381_10669383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	903	Open in IMG/M
3300012207\|Ga0137381_10877994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	776	Open in IMG/M
3300012207\|Ga0137381_11099923	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	684	Open in IMG/M
3300012207\|Ga0137381_11408317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	589	Open in IMG/M
3300012211\|Ga0137377_11445397	All Organisms → cellular organisms → Bacteria → Proteobacteria	615	Open in IMG/M
3300012285\|Ga0137370_10012190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	4139	Open in IMG/M
3300012285\|Ga0137370_10079272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	1818	Open in IMG/M
3300012285\|Ga0137370_10911984	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	543	Open in IMG/M
3300012349\|Ga0137387_10059680	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2570	Open in IMG/M
3300012353\|Ga0137367_10491721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	865	Open in IMG/M
3300012355\|Ga0137369_10643630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	733	Open in IMG/M
3300012356\|Ga0137371_10024763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	4621	Open in IMG/M
3300012357\|Ga0137384_10173785	Not Available	1803	Open in IMG/M
3300012357\|Ga0137384_10429846	All Organisms → cellular organisms → Bacteria → Proteobacteria	1088	Open in IMG/M
3300012361\|Ga0137360_10699873	All Organisms → cellular organisms → Bacteria → Proteobacteria	870	Open in IMG/M
3300012532\|Ga0137373_10315338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1238	Open in IMG/M
3300012683\|Ga0137398_10047681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2523	Open in IMG/M
3300012685\|Ga0137397_10001900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	14577	Open in IMG/M
3300012685\|Ga0137397_10035652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3554	Open in IMG/M
3300012685\|Ga0137397_10198773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1491	Open in IMG/M
3300012685\|Ga0137397_11149395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	562	Open in IMG/M
3300012922\|Ga0137394_10432524	All Organisms → cellular organisms → Bacteria → Proteobacteria	1121	Open in IMG/M
3300012922\|Ga0137394_10624972	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	910	Open in IMG/M
3300012925\|Ga0137419_10594587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	888	Open in IMG/M
3300012925\|Ga0137419_10664409	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	842	Open in IMG/M
3300012925\|Ga0137419_11210047	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	633	Open in IMG/M
3300012931\|Ga0153915_11299243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	850	Open in IMG/M
3300012944\|Ga0137410_10000615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	24756	Open in IMG/M
3300012944\|Ga0137410_11077324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	687	Open in IMG/M
3300012944\|Ga0137410_11310029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	627	Open in IMG/M
3300012944\|Ga0137410_11327301	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	623	Open in IMG/M
3300012948\|Ga0126375_11748662	All Organisms → cellular organisms → Bacteria → Proteobacteria	541	Open in IMG/M
3300012971\|Ga0126369_10537192	All Organisms → cellular organisms → Bacteria	1232	Open in IMG/M
3300012971\|Ga0126369_11187819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	853	Open in IMG/M
3300012972\|Ga0134077_10311642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	663	Open in IMG/M
3300014150\|Ga0134081_10224681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	647	Open in IMG/M
3300014262\|Ga0075301_1007760	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1598	Open in IMG/M
3300014308\|Ga0075354_1004527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	1792	Open in IMG/M
3300014321\|Ga0075353_1006580	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1782	Open in IMG/M
3300014321\|Ga0075353_1033165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1004	Open in IMG/M
3300015052\|Ga0137411_1221217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2511	Open in IMG/M
3300015054\|Ga0137420_1445557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	996	Open in IMG/M
3300015242\|Ga0137412_10006904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	9106	Open in IMG/M
3300015242\|Ga0137412_10393023	All Organisms → cellular organisms → Bacteria → Proteobacteria	1074	Open in IMG/M
3300015245\|Ga0137409_10007249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	11413	Open in IMG/M
3300015245\|Ga0137409_10010245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	9479	Open in IMG/M
3300017654\|Ga0134069_1331539	All Organisms → cellular organisms → Bacteria → Proteobacteria	545	Open in IMG/M
3300017657\|Ga0134074_1080683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1110	Open in IMG/M
3300017659\|Ga0134083_10214803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	797	Open in IMG/M
3300017939\|Ga0187775_10022848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1728	Open in IMG/M
3300017944\|Ga0187786_10125389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	898	Open in IMG/M
3300017959\|Ga0187779_10205195	All Organisms → cellular organisms → Bacteria → Proteobacteria	1234	Open in IMG/M
3300017974\|Ga0187777_11333019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	528	Open in IMG/M
3300017997\|Ga0184610_1048372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1250	Open in IMG/M
3300018000\|Ga0184604_10063681	Not Available	1057	Open in IMG/M
3300018031\|Ga0184634_10187645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	938	Open in IMG/M
3300018056\|Ga0184623_10020087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2957	Open in IMG/M
3300018060\|Ga0187765_10124290	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1432	Open in IMG/M
3300018063\|Ga0184637_10013017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	4998	Open in IMG/M
3300018064\|Ga0187773_10005528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	5183	Open in IMG/M
3300018071\|Ga0184618_10064822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1363	Open in IMG/M
3300018074\|Ga0184640_10001442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7164	Open in IMG/M
3300018074\|Ga0184640_10315493	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	709	Open in IMG/M
3300018078\|Ga0184612_10238670	All Organisms → cellular organisms → Bacteria → Proteobacteria	940	Open in IMG/M
3300018082\|Ga0184639_10258882	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	919	Open in IMG/M
3300018083\|Ga0184628_10234597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	962	Open in IMG/M
3300018433\|Ga0066667_10141423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1681	Open in IMG/M
3300018433\|Ga0066667_10493529	All Organisms → cellular organisms → Bacteria → Proteobacteria	1007	Open in IMG/M
3300018433\|Ga0066667_10621397	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	902	Open in IMG/M
3300018468\|Ga0066662_10147952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1770	Open in IMG/M
3300019245\|Ga0187791_1179133	All Organisms → cellular organisms → Bacteria → Proteobacteria	584	Open in IMG/M
3300019255\|Ga0184643_1297255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	682	Open in IMG/M
3300019789\|Ga0137408_1173201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	2709	Open in IMG/M
3300019872\|Ga0193754_1002903	All Organisms → cellular organisms → Bacteria	1587	Open in IMG/M
3300019880\|Ga0193712_1087367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	677	Open in IMG/M
3300019883\|Ga0193725_1032119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1397	Open in IMG/M
3300019997\|Ga0193711_1009647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1217	Open in IMG/M
3300020010\|Ga0193749_1028488	All Organisms → cellular organisms → Bacteria → Proteobacteria	1086	Open in IMG/M
3300020021\|Ga0193726_1002000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	14511	Open in IMG/M
3300020170\|Ga0179594_10001871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	4811	Open in IMG/M
3300020170\|Ga0179594_10054896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1353	Open in IMG/M
3300020170\|Ga0179594_10091803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1082	Open in IMG/M
3300021086\|Ga0179596_10025601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2206	Open in IMG/M
3300021086\|Ga0179596_10219669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	930	Open in IMG/M
3300021560\|Ga0126371_11106779	Not Available	931	Open in IMG/M
3300025922\|Ga0207646_10424605	All Organisms → cellular organisms → Bacteria → Proteobacteria	1200	Open in IMG/M
3300025954\|Ga0210135_1002892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1373	Open in IMG/M
3300025979\|Ga0210078_1002246	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	2059	Open in IMG/M
3300025985\|Ga0210117_1035011	Not Available	792	Open in IMG/M
3300026277\|Ga0209350_1002294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7554	Open in IMG/M
3300026285\|Ga0209438_1085588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	998	Open in IMG/M
3300026295\|Ga0209234_1122568	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	956	Open in IMG/M
3300026296\|Ga0209235_1141756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	974	Open in IMG/M
3300026297\|Ga0209237_1129965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1035	Open in IMG/M
3300026298\|Ga0209236_1028511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3015	Open in IMG/M
3300026298\|Ga0209236_1074446	All Organisms → cellular organisms → Bacteria → Proteobacteria	1594	Open in IMG/M
3300026316\|Ga0209155_1119954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	917	Open in IMG/M
3300026320\|Ga0209131_1410380	All Organisms → cellular organisms → Bacteria → Proteobacteria	508	Open in IMG/M
3300026334\|Ga0209377_1315007	All Organisms → cellular organisms → Bacteria → Proteobacteria	523	Open in IMG/M
3300026340\|Ga0257162_1039443	All Organisms → cellular organisms → Bacteria → Proteobacteria	590	Open in IMG/M
3300026529\|Ga0209806_1057422	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1801	Open in IMG/M
3300026538\|Ga0209056_10059762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3343	Open in IMG/M
3300026548\|Ga0209161_10012834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	6239	Open in IMG/M
3300026557\|Ga0179587_10989460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	554	Open in IMG/M
3300026557\|Ga0179587_11018821	All Organisms → cellular organisms → Bacteria → Proteobacteria	545	Open in IMG/M
3300027388\|Ga0208995_1044625	All Organisms → cellular organisms → Bacteria	780	Open in IMG/M
3300027573\|Ga0208454_1000074	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	70190	Open in IMG/M
3300027633\|Ga0208988_1009519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2420	Open in IMG/M
3300027671\|Ga0209588_1064727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1182	Open in IMG/M
3300027821\|Ga0209811_10000399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	18688	Open in IMG/M
3300027842\|Ga0209580_10002615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	7741	Open in IMG/M
3300027846\|Ga0209180_10275984	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	965	Open in IMG/M
3300027846\|Ga0209180_10715510	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri	543	Open in IMG/M
3300027875\|Ga0209283_10370530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	937	Open in IMG/M
3300027882\|Ga0209590_10259683	All Organisms → cellular organisms → Bacteria → Proteobacteria	1110	Open in IMG/M
3300027882\|Ga0209590_10624272	All Organisms → cellular organisms → Eukaryota	693	Open in IMG/M
3300027882\|Ga0209590_10972393	All Organisms → cellular organisms → Bacteria → Proteobacteria	531	Open in IMG/M
3300028792\|Ga0307504_10057708	All Organisms → cellular organisms → Bacteria → Proteobacteria	1129	Open in IMG/M
3300028802\|Ga0307503_10158943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1033	Open in IMG/M
3300031152\|Ga0307501_10001732	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	2510	Open in IMG/M
3300031170\|Ga0307498_10153125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	767	Open in IMG/M
3300031199\|Ga0307495_10024927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1048	Open in IMG/M
3300031199\|Ga0307495_10170678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	577	Open in IMG/M
3300031199\|Ga0307495_10239026	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	517	Open in IMG/M
3300031226\|Ga0307497_10004327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	3730	Open in IMG/M
3300031679\|Ga0318561_10212529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1050	Open in IMG/M
3300031720\|Ga0307469_10000003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	313784	Open in IMG/M
3300031720\|Ga0307469_10008196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4920	Open in IMG/M
3300031720\|Ga0307469_10013586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	4131	Open in IMG/M
3300031720\|Ga0307469_10020092	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3606	Open in IMG/M
3300031720\|Ga0307469_10119369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	1903	Open in IMG/M
3300031740\|Ga0307468_100290765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1179	Open in IMG/M
3300031820\|Ga0307473_10017441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2831	Open in IMG/M
3300031820\|Ga0307473_10102654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1526	Open in IMG/M
3300031820\|Ga0307473_10566299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	778	Open in IMG/M
3300032180\|Ga0307471_100009956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	6334	Open in IMG/M
3300032180\|Ga0307471_100270528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1766	Open in IMG/M
3300032180\|Ga0307471_100333747	Not Available	1619	Open in IMG/M
3300032180\|Ga0307471_103655536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	544	Open in IMG/M
3300032205\|Ga0307472_100626113	Not Available	954	Open in IMG/M
3300032770\|Ga0335085_10003524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	26964	Open in IMG/M
3300032783\|Ga0335079_10306496	All Organisms → cellular organisms → Bacteria	1732	Open in IMG/M
3300033004\|Ga0335084_10003551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	15221	Open in IMG/M
3300033004\|Ga0335084_11081566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	805	Open in IMG/M
3300033158\|Ga0335077_10215076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2151	Open in IMG/M
3300033432\|Ga0326729_1057820	All Organisms → cellular organisms → Bacteria → Proteobacteria	595	Open in IMG/M
3300033433\|Ga0326726_10008500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	9117	Open in IMG/M
3300033433\|Ga0326726_10044637	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3875	Open in IMG/M
3300033759\|Ga0314869_018534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	518	Open in IMG/M
3300033803\|Ga0314862_0060063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	834	Open in IMG/M
3300033804\|Ga0314863_028036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1139	Open in IMG/M
3300033809\|Ga0314871_002562	Not Available	1058	Open in IMG/M
3300033810\|Ga0314872_014615	All Organisms → cellular organisms → Bacteria → Proteobacteria	636	Open in IMG/M
3300033811\|Ga0364924_089021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	692	Open in IMG/M
3300033814\|Ga0364930_0049840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1423	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.91%
Host-Associated	Host-Associated	1.09%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	85.51%
Aquatic	Environmental → Aquatic	13.41%
Plants	Host-Associated → Plants	1.09%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	83.70%
Sediment	Environmental → Aquatic → Sediment	11.59%
Marine	Environmental → Aquatic → Marine	1.09%
Peat	Environmental → Terrestrial → Peat	1.09%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.09%
Freshwater	Environmental → Aquatic → Freshwater	0.72%
Floodplain	Environmental → Terrestrial → Floodplain	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	72.10%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	11.59%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.97%
Loam	Environmental → Terrestrial → Soil → Loam	3.62%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.09%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.09%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.72%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.36%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.36%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	52.90%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.68%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	11.59%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.97%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.80%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.17%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.09%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.09%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.09%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.72%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.72%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.36%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.36%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.36%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	34.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.07%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	5.07%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.07%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	4.71%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.99%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.26%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	2.17%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	2.17%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.17%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.81%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.81%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.45%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.45%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.09%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.09%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.09%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.09%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.72%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.72%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.72%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.36%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.36%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.36%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.36%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2032320006	Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+	Environmental	Open in IMG/M
3300002558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm	Environmental	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005830	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM	Environmental	Open in IMG/M
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005875	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009597	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011410	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300011433	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2	Environmental	Open in IMG/M
3300011438	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2	Environmental	Open in IMG/M
3300011441	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2	Environmental	Open in IMG/M
3300011442	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014262	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1	Environmental	Open in IMG/M
3300014308	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1	Environmental	Open in IMG/M
3300014321	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1	Environmental	Open in IMG/M
3300015052	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300017654	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019245	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019255	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300019872	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1	Environmental	Open in IMG/M
3300019880	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1	Environmental	Open in IMG/M
3300019883	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2	Environmental	Open in IMG/M
3300019997	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2	Environmental	Open in IMG/M
3300020010	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2	Environmental	Open in IMG/M
3300020021	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025954	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 (SPAdes)	Environmental	Open in IMG/M
3300025979	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025985	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes)	Environmental	Open in IMG/M
3300026277	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026296	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026316	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300026334	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)	Environmental	Open in IMG/M
3300026340	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A	Environmental	Open in IMG/M
3300026529	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027388	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)	Environmental	Open in IMG/M
3300027573	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)	Environmental	Open in IMG/M
3300027633	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)	Environmental	Open in IMG/M
3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031199	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033158	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1	Environmental	Open in IMG/M
3300033432	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033759	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_B	Environmental	Open in IMG/M
3300033803	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10	Environmental	Open in IMG/M
3300033804	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20	Environmental	Open in IMG/M
3300033809	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_D	Environmental	Open in IMG/M
3300033810	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E	Environmental	Open in IMG/M
3300033811	Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17	Environmental	Open in IMG/M
3300033814	Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F012904

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign