| Basic Information | |
|---|---|
| Family ID | F010948 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 297 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Number of Associated Samples | 181 |
| Number of Associated Scaffolds | 297 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.73 % |
| % of genes near scaffold ends (potentially truncated) | 34.34 % |
| % of genes from short scaffolds (< 2000 bps) | 93.60 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (38.384 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (27.946 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.707 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (66.330 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 297 Family Scaffolds |
|---|---|---|
| PF12957 | DUF3846 | 2.02 |
| PF03237 | Terminase_6N | 1.35 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.30 % |
| Unclassified | root | N/A | 36.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10077360 | Not Available | 1494 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10102718 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10143338 | All Organisms → Viruses → environmental samples → uncultured virus | 891 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10154778 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 835 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10172115 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 762 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10187792 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 708 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10213028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 637 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10218105 | Not Available | 625 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10237766 | Not Available | 582 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10257892 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 544 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10054908 | Not Available | 1540 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10207592 | Not Available | 542 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10065406 | All Organisms → Viruses → Predicted Viral | 1505 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10142445 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 833 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10220039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 596 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10252319 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 537 | Open in IMG/M |
| 3300000148|SI47jul10_100mDRAFT_c1039855 | Not Available | 645 | Open in IMG/M |
| 3300001450|JGI24006J15134_10029573 | Not Available | 2420 | Open in IMG/M |
| 3300001450|JGI24006J15134_10112728 | Not Available | 955 | Open in IMG/M |
| 3300001450|JGI24006J15134_10137270 | Not Available | 820 | Open in IMG/M |
| 3300001450|JGI24006J15134_10144410 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 788 | Open in IMG/M |
| 3300001450|JGI24006J15134_10175836 | Not Available | 676 | Open in IMG/M |
| 3300001450|JGI24006J15134_10181329 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 660 | Open in IMG/M |
| 3300001450|JGI24006J15134_10199903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300001450|JGI24006J15134_10236458 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 533 | Open in IMG/M |
| 3300001450|JGI24006J15134_10249307 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 511 | Open in IMG/M |
| 3300001450|JGI24006J15134_10252739 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 505 | Open in IMG/M |
| 3300001460|JGI24003J15210_10104817 | Not Available | 801 | Open in IMG/M |
| 3300001460|JGI24003J15210_10108450 | Not Available | 780 | Open in IMG/M |
| 3300001460|JGI24003J15210_10112497 | Not Available | 757 | Open in IMG/M |
| 3300001460|JGI24003J15210_10124961 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 695 | Open in IMG/M |
| 3300001460|JGI24003J15210_10138373 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 639 | Open in IMG/M |
| 3300001460|JGI24003J15210_10143549 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 620 | Open in IMG/M |
| 3300001460|JGI24003J15210_10147881 | Not Available | 605 | Open in IMG/M |
| 3300001460|JGI24003J15210_10158848 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 570 | Open in IMG/M |
| 3300001472|JGI24004J15324_10069726 | All Organisms → Viruses → environmental samples → uncultured virus | 983 | Open in IMG/M |
| 3300001472|JGI24004J15324_10102544 | Not Available | 732 | Open in IMG/M |
| 3300001472|JGI24004J15324_10117874 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 655 | Open in IMG/M |
| 3300001472|JGI24004J15324_10156517 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 521 | Open in IMG/M |
| 3300001589|JGI24005J15628_10105251 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 939 | Open in IMG/M |
| 3300001589|JGI24005J15628_10226671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300001720|JGI24513J20088_1012132 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300001853|JGI24524J20080_1017826 | All Organisms → Viruses → environmental samples → uncultured virus | 756 | Open in IMG/M |
| 3300003478|JGI26238J51125_1112860 | Not Available | 508 | Open in IMG/M |
| 3300003619|JGI26380J51729_10096735 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 663 | Open in IMG/M |
| 3300004448|Ga0065861_1049169 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 616 | Open in IMG/M |
| 3300004951|Ga0068513_1004890 | Not Available | 1400 | Open in IMG/M |
| 3300005820|Ga0078747_150472 | Not Available | 897 | Open in IMG/M |
| 3300005912|Ga0075109_1192939 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 640 | Open in IMG/M |
| 3300005914|Ga0075117_1211620 | Not Available | 537 | Open in IMG/M |
| 3300005919|Ga0075114_10052064 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| 3300005933|Ga0075118_10279662 | Not Available | 514 | Open in IMG/M |
| 3300006025|Ga0075474_10115929 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 857 | Open in IMG/M |
| 3300006025|Ga0075474_10202483 | Not Available | 608 | Open in IMG/M |
| 3300006026|Ga0075478_10127556 | Not Available | 801 | Open in IMG/M |
| 3300006026|Ga0075478_10254568 | Not Available | 526 | Open in IMG/M |
| 3300006027|Ga0075462_10044001 | Not Available | 1425 | Open in IMG/M |
| 3300006029|Ga0075466_1174809 | Not Available | 542 | Open in IMG/M |
| 3300006164|Ga0075441_10257872 | Not Available | 641 | Open in IMG/M |
| 3300006164|Ga0075441_10276673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300006165|Ga0075443_10223570 | Not Available | 678 | Open in IMG/M |
| 3300006190|Ga0075446_10149101 | Not Available | 667 | Open in IMG/M |
| 3300006190|Ga0075446_10150459 | Not Available | 663 | Open in IMG/M |
| 3300006402|Ga0075511_1087742 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 921 | Open in IMG/M |
| 3300006802|Ga0070749_10413776 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 742 | Open in IMG/M |
| 3300006802|Ga0070749_10548298 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 627 | Open in IMG/M |
| 3300006867|Ga0075476_10080999 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 1267 | Open in IMG/M |
| 3300006867|Ga0075476_10263217 | All Organisms → Viruses → environmental samples → uncultured virus | 612 | Open in IMG/M |
| 3300006868|Ga0075481_10081243 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300006870|Ga0075479_10303177 | Not Available | 626 | Open in IMG/M |
| 3300006874|Ga0075475_10335857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 617 | Open in IMG/M |
| 3300006922|Ga0098045_1148614 | Not Available | 540 | Open in IMG/M |
| 3300006947|Ga0075444_10192723 | Not Available | 828 | Open in IMG/M |
| 3300006947|Ga0075444_10254549 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 689 | Open in IMG/M |
| 3300007234|Ga0075460_10162656 | Not Available | 773 | Open in IMG/M |
| 3300007345|Ga0070752_1280692 | Not Available | 639 | Open in IMG/M |
| 3300007533|Ga0102944_1079690 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300007541|Ga0099848_1216786 | Not Available | 681 | Open in IMG/M |
| 3300007708|Ga0102859_1283491 | Not Available | 500 | Open in IMG/M |
| 3300007725|Ga0102951_1066137 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300008012|Ga0075480_10540301 | Not Available | 557 | Open in IMG/M |
| 3300008221|Ga0114916_1119150 | All Organisms → Viruses → environmental samples → uncultured virus | 619 | Open in IMG/M |
| 3300009000|Ga0102960_1132397 | All Organisms → Viruses → environmental samples → uncultured virus | 902 | Open in IMG/M |
| 3300009001|Ga0102963_1161872 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 899 | Open in IMG/M |
| 3300009027|Ga0102957_1406333 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 510 | Open in IMG/M |
| 3300009035|Ga0102958_1195400 | Not Available | 672 | Open in IMG/M |
| 3300009071|Ga0115566_10724336 | Not Available | 550 | Open in IMG/M |
| 3300009074|Ga0115549_1089693 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300009074|Ga0115549_1196120 | Not Available | 646 | Open in IMG/M |
| 3300009077|Ga0115552_1362937 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 573 | Open in IMG/M |
| 3300009149|Ga0114918_10326135 | Not Available | 852 | Open in IMG/M |
| 3300009172|Ga0114995_10417285 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 736 | Open in IMG/M |
| 3300009173|Ga0114996_11255119 | Not Available | 517 | Open in IMG/M |
| 3300009193|Ga0115551_1120193 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
| 3300009409|Ga0114993_10320094 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300009420|Ga0114994_10452608 | Not Available | 848 | Open in IMG/M |
| 3300009422|Ga0114998_10040400 | All Organisms → Viruses → Predicted Viral | 2523 | Open in IMG/M |
| 3300009422|Ga0114998_10260683 | All Organisms → Viruses → environmental samples → uncultured virus | 816 | Open in IMG/M |
| 3300009422|Ga0114998_10331753 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 712 | Open in IMG/M |
| 3300009423|Ga0115548_1213280 | Not Available | 596 | Open in IMG/M |
| 3300009428|Ga0114915_1088978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 932 | Open in IMG/M |
| 3300009432|Ga0115005_10718565 | Not Available | 803 | Open in IMG/M |
| 3300009433|Ga0115545_1248048 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 598 | Open in IMG/M |
| 3300009440|Ga0115561_1143565 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 941 | Open in IMG/M |
| 3300009441|Ga0115007_10072944 | All Organisms → Viruses → Predicted Viral | 2163 | Open in IMG/M |
| 3300009499|Ga0114930_10206507 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 993 | Open in IMG/M |
| 3300009785|Ga0115001_10769251 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 581 | Open in IMG/M |
| 3300010316|Ga0136655_1040201 | All Organisms → Viruses → Predicted Viral | 1487 | Open in IMG/M |
| 3300010368|Ga0129324_10434108 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 505 | Open in IMG/M |
| 3300010392|Ga0118731_115224210 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 642 | Open in IMG/M |
| 3300010883|Ga0133547_11081356 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300011118|Ga0114922_11614924 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300017697|Ga0180120_10214920 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 792 | Open in IMG/M |
| 3300017713|Ga0181391_1097120 | Not Available | 667 | Open in IMG/M |
| 3300017714|Ga0181412_1126456 | Not Available | 586 | Open in IMG/M |
| 3300017717|Ga0181404_1099272 | Not Available | 714 | Open in IMG/M |
| 3300017728|Ga0181419_1173923 | Not Available | 510 | Open in IMG/M |
| 3300017734|Ga0187222_1104173 | Not Available | 641 | Open in IMG/M |
| 3300017753|Ga0181407_1067517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 921 | Open in IMG/M |
| 3300017758|Ga0181409_1169224 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 636 | Open in IMG/M |
| 3300017762|Ga0181422_1242693 | Not Available | 534 | Open in IMG/M |
| 3300017767|Ga0181406_1074089 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300017767|Ga0181406_1108325 | Not Available | 839 | Open in IMG/M |
| 3300017768|Ga0187220_1140809 | All Organisms → Viruses → environmental samples → uncultured virus | 729 | Open in IMG/M |
| 3300017781|Ga0181423_1267517 | Not Available | 636 | Open in IMG/M |
| 3300019073|Ga0188855_1001414 | Not Available | 578 | Open in IMG/M |
| 3300019708|Ga0194016_1052232 | Not Available | 523 | Open in IMG/M |
| 3300019721|Ga0194011_1032899 | Not Available | 611 | Open in IMG/M |
| 3300019728|Ga0193996_1014030 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 904 | Open in IMG/M |
| 3300019750|Ga0194000_1023208 | Not Available | 814 | Open in IMG/M |
| 3300019756|Ga0194023_1020312 | All Organisms → Viruses → environmental samples → uncultured virus | 1343 | Open in IMG/M |
| 3300019756|Ga0194023_1073496 | Not Available | 686 | Open in IMG/M |
| 3300020185|Ga0206131_10008002 | All Organisms → cellular organisms → Bacteria | 10469 | Open in IMG/M |
| 3300020185|Ga0206131_10222485 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 905 | Open in IMG/M |
| 3300020438|Ga0211576_10651436 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 520 | Open in IMG/M |
| 3300021335|Ga0213867_1109367 | Not Available | 982 | Open in IMG/M |
| 3300021347|Ga0213862_10238379 | Not Available | 641 | Open in IMG/M |
| 3300021365|Ga0206123_10194873 | Not Available | 904 | Open in IMG/M |
| 3300021371|Ga0213863_10047376 | Not Available | 2252 | Open in IMG/M |
| 3300021957|Ga0222717_10262046 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300021958|Ga0222718_10090487 | All Organisms → Viruses → Predicted Viral | 1823 | Open in IMG/M |
| 3300021960|Ga0222715_10254982 | All Organisms → Viruses → environmental samples → uncultured virus | 1018 | Open in IMG/M |
| 3300021960|Ga0222715_10644599 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 540 | Open in IMG/M |
| 3300021964|Ga0222719_10826366 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 506 | Open in IMG/M |
| 3300022046|Ga0224897_100351 | Not Available | 1294 | Open in IMG/M |
| 3300022053|Ga0212030_1023054 | Not Available | 846 | Open in IMG/M |
| 3300022053|Ga0212030_1025293 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 813 | Open in IMG/M |
| 3300022053|Ga0212030_1065633 | Not Available | 517 | Open in IMG/M |
| 3300022065|Ga0212024_1061937 | Not Available | 661 | Open in IMG/M |
| 3300022065|Ga0212024_1063683 | Not Available | 652 | Open in IMG/M |
| 3300022167|Ga0212020_1028403 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300022169|Ga0196903_1044749 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 514 | Open in IMG/M |
| 3300022178|Ga0196887_1113705 | Not Available | 590 | Open in IMG/M |
| 3300022183|Ga0196891_1075378 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 600 | Open in IMG/M |
| 3300022220|Ga0224513_10379134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 569 | Open in IMG/M |
| 3300022822|Ga0222646_124240 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300022851|Ga0222691_1042389 | Not Available | 623 | Open in IMG/M |
| 3300022851|Ga0222691_1050060 | Not Available | 551 | Open in IMG/M |
| (restricted) 3300022902|Ga0233429_1028367 | Not Available | 2989 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10096128 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10127451 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 1080 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10182562 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 906 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10400219 | Not Available | 614 | Open in IMG/M |
| 3300023229|Ga0222661_1042551 | All Organisms → Viruses | 590 | Open in IMG/M |
| 3300023235|Ga0222634_1064715 | Not Available | 503 | Open in IMG/M |
| 3300023242|Ga0222708_1057269 | Not Available | 535 | Open in IMG/M |
| 3300023294|Ga0222670_1054578 | Not Available | 584 | Open in IMG/M |
| (restricted) 3300024052|Ga0255050_10078342 | Not Available | 739 | Open in IMG/M |
| 3300024236|Ga0228655_1108026 | Not Available | 587 | Open in IMG/M |
| (restricted) 3300024258|Ga0233440_1072514 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| (restricted) 3300024259|Ga0233437_1178071 | All Organisms → Viruses → environmental samples → uncultured virus | 931 | Open in IMG/M |
| 3300024262|Ga0210003_1042698 | Not Available | 2392 | Open in IMG/M |
| 3300024262|Ga0210003_1067667 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300024262|Ga0210003_1276823 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10347153 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 683 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10510039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 558 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10217058 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 932 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10368091 | Not Available | 679 | Open in IMG/M |
| 3300025048|Ga0207905_1003636 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 3026 | Open in IMG/M |
| 3300025048|Ga0207905_1011806 | All Organisms → Viruses → Predicted Viral | 1513 | Open in IMG/M |
| 3300025048|Ga0207905_1015755 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300025048|Ga0207905_1026479 | All Organisms → Viruses → environmental samples → uncultured virus | 952 | Open in IMG/M |
| 3300025048|Ga0207905_1029542 | All Organisms → Viruses → environmental samples → uncultured virus | 892 | Open in IMG/M |
| 3300025048|Ga0207905_1063191 | Not Available | 552 | Open in IMG/M |
| 3300025052|Ga0207906_1055269 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 527 | Open in IMG/M |
| 3300025071|Ga0207896_1034846 | Not Available | 849 | Open in IMG/M |
| 3300025071|Ga0207896_1056269 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 636 | Open in IMG/M |
| 3300025071|Ga0207896_1056784 | Not Available | 632 | Open in IMG/M |
| 3300025079|Ga0207890_1003943 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 3550 | Open in IMG/M |
| 3300025079|Ga0207890_1037288 | All Organisms → Viruses → environmental samples → uncultured virus | 868 | Open in IMG/M |
| 3300025086|Ga0208157_1082853 | Not Available | 798 | Open in IMG/M |
| 3300025110|Ga0208158_1037116 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300025120|Ga0209535_1005404 | All Organisms → cellular organisms → Bacteria | 7830 | Open in IMG/M |
| 3300025120|Ga0209535_1035259 | All Organisms → Viruses → Predicted Viral | 2308 | Open in IMG/M |
| 3300025120|Ga0209535_1067303 | All Organisms → Viruses → environmental samples → uncultured virus | 1426 | Open in IMG/M |
| 3300025120|Ga0209535_1081706 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
| 3300025120|Ga0209535_1085514 | All Organisms → Viruses → Predicted Viral | 1179 | Open in IMG/M |
| 3300025120|Ga0209535_1098623 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300025120|Ga0209535_1146202 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 754 | Open in IMG/M |
| 3300025120|Ga0209535_1222786 | Not Available | 505 | Open in IMG/M |
| 3300025132|Ga0209232_1062897 | Not Available | 1325 | Open in IMG/M |
| 3300025137|Ga0209336_10112886 | Not Available | 753 | Open in IMG/M |
| 3300025138|Ga0209634_1009557 | Not Available | 5917 | Open in IMG/M |
| 3300025138|Ga0209634_1158886 | Not Available | 912 | Open in IMG/M |
| 3300025138|Ga0209634_1197073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300025168|Ga0209337_1060226 | All Organisms → Viruses → Predicted Viral | 1920 | Open in IMG/M |
| 3300025168|Ga0209337_1060683 | All Organisms → Viruses → Predicted Viral | 1910 | Open in IMG/M |
| 3300025168|Ga0209337_1121734 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
| 3300025168|Ga0209337_1134588 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300025168|Ga0209337_1206856 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 792 | Open in IMG/M |
| 3300025237|Ga0208031_1030595 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 709 | Open in IMG/M |
| 3300025508|Ga0208148_1052429 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300025508|Ga0208148_1066613 | Not Available | 846 | Open in IMG/M |
| 3300025590|Ga0209195_1051866 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
| 3300025626|Ga0209716_1137619 | All Organisms → Viruses | 647 | Open in IMG/M |
| 3300025645|Ga0208643_1012233 | Not Available | 3232 | Open in IMG/M |
| 3300025645|Ga0208643_1171045 | Not Available | 534 | Open in IMG/M |
| 3300025652|Ga0208134_1118595 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 706 | Open in IMG/M |
| 3300025652|Ga0208134_1159123 | Not Available | 561 | Open in IMG/M |
| 3300025653|Ga0208428_1050537 | Not Available | 1265 | Open in IMG/M |
| 3300025671|Ga0208898_1053972 | Not Available | 1438 | Open in IMG/M |
| 3300025671|Ga0208898_1184426 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 523 | Open in IMG/M |
| 3300025688|Ga0209140_1157281 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 660 | Open in IMG/M |
| 3300025759|Ga0208899_1178068 | Not Available | 697 | Open in IMG/M |
| 3300025803|Ga0208425_1081911 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 770 | Open in IMG/M |
| 3300025818|Ga0208542_1007138 | All Organisms → Viruses | 4053 | Open in IMG/M |
| 3300025840|Ga0208917_1264275 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 546 | Open in IMG/M |
| 3300025853|Ga0208645_1207563 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 688 | Open in IMG/M |
| 3300025853|Ga0208645_1277700 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 540 | Open in IMG/M |
| 3300026138|Ga0209951_1128465 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 511 | Open in IMG/M |
| 3300027522|Ga0209384_1020906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 2079 | Open in IMG/M |
| 3300027522|Ga0209384_1029181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1647 | Open in IMG/M |
| 3300027522|Ga0209384_1069905 | Not Available | 895 | Open in IMG/M |
| 3300027672|Ga0209383_1106555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 929 | Open in IMG/M |
| 3300027687|Ga0209710_1031858 | All Organisms → Viruses → Predicted Viral | 2587 | Open in IMG/M |
| 3300027687|Ga0209710_1155338 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 826 | Open in IMG/M |
| 3300027704|Ga0209816_1038445 | All Organisms → Viruses → Predicted Viral | 2279 | Open in IMG/M |
| 3300027788|Ga0209711_10430793 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 533 | Open in IMG/M |
| 3300027810|Ga0209302_10159286 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
| 3300027813|Ga0209090_10286328 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 822 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10201492 | All Organisms → Viruses → environmental samples → uncultured virus | 976 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10543896 | Not Available | 562 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10339438 | Not Available | 713 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10154839 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
| 3300028125|Ga0256368_1019708 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300028125|Ga0256368_1023480 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300028125|Ga0256368_1028224 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300028125|Ga0256368_1037262 | All Organisms → Viruses → environmental samples → uncultured virus | 866 | Open in IMG/M |
| 3300028125|Ga0256368_1045400 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 777 | Open in IMG/M |
| 3300028125|Ga0256368_1055732 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 690 | Open in IMG/M |
| 3300028125|Ga0256368_1059322 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 665 | Open in IMG/M |
| 3300028125|Ga0256368_1085970 | Not Available | 532 | Open in IMG/M |
| 3300028196|Ga0257114_1069092 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
| 3300031227|Ga0307928_10078348 | All Organisms → Viruses → Predicted Viral | 1998 | Open in IMG/M |
| 3300031519|Ga0307488_10229224 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
| 3300031519|Ga0307488_10276553 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
| 3300031519|Ga0307488_10314147 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300031519|Ga0307488_10365401 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 904 | Open in IMG/M |
| 3300031519|Ga0307488_10381322 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 878 | Open in IMG/M |
| 3300031519|Ga0307488_10394135 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 858 | Open in IMG/M |
| 3300031519|Ga0307488_10509803 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 716 | Open in IMG/M |
| 3300031519|Ga0307488_10534199 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 693 | Open in IMG/M |
| 3300031519|Ga0307488_10558074 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 672 | Open in IMG/M |
| 3300031519|Ga0307488_10617396 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 626 | Open in IMG/M |
| 3300031519|Ga0307488_10658570 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 598 | Open in IMG/M |
| 3300031519|Ga0307488_10694741 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 576 | Open in IMG/M |
| 3300031519|Ga0307488_10723054 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 560 | Open in IMG/M |
| 3300031519|Ga0307488_10724485 | Not Available | 559 | Open in IMG/M |
| 3300031519|Ga0307488_10743436 | Not Available | 549 | Open in IMG/M |
| 3300031519|Ga0307488_10847477 | Not Available | 501 | Open in IMG/M |
| 3300031539|Ga0307380_10234149 | All Organisms → Viruses → Predicted Viral | 1747 | Open in IMG/M |
| 3300031539|Ga0307380_11013090 | Not Available | 661 | Open in IMG/M |
| 3300031566|Ga0307378_11338781 | Not Available | 556 | Open in IMG/M |
| 3300031569|Ga0307489_10041554 | All Organisms → Viruses → Predicted Viral | 2528 | Open in IMG/M |
| 3300031588|Ga0302137_1078872 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300031588|Ga0302137_1211591 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 667 | Open in IMG/M |
| 3300031596|Ga0302134_10134567 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
| 3300031596|Ga0302134_10173856 | All Organisms → Viruses → environmental samples → uncultured virus | 887 | Open in IMG/M |
| 3300031605|Ga0302132_10431389 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 589 | Open in IMG/M |
| 3300031621|Ga0302114_10184726 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300031627|Ga0302118_10458197 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 565 | Open in IMG/M |
| 3300031658|Ga0307984_1149477 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 653 | Open in IMG/M |
| 3300031669|Ga0307375_10133222 | All Organisms → Viruses → Predicted Viral | 1741 | Open in IMG/M |
| 3300031673|Ga0307377_10570891 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 813 | Open in IMG/M |
| 3300031700|Ga0302130_1028589 | Not Available | 1878 | Open in IMG/M |
| 3300032251|Ga0316198_10371766 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 800 | Open in IMG/M |
| 3300032254|Ga0316208_1113012 | Not Available | 655 | Open in IMG/M |
| 3300032257|Ga0316205_10278097 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 594 | Open in IMG/M |
| 3300032274|Ga0316203_1230274 | Not Available | 509 | Open in IMG/M |
| 3300032277|Ga0316202_10285074 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 769 | Open in IMG/M |
| 3300033742|Ga0314858_037135 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| 3300033742|Ga0314858_059149 | All Organisms → Viruses → environmental samples → uncultured virus | 939 | Open in IMG/M |
| 3300033742|Ga0314858_128771 | Not Available | 648 | Open in IMG/M |
| 3300034374|Ga0348335_089338 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
| 3300034375|Ga0348336_023295 | All Organisms → Viruses → Predicted Viral | 3124 | Open in IMG/M |
| 3300034375|Ga0348336_094418 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 1034 | Open in IMG/M |
| 3300034375|Ga0348336_153225 | Not Available | 682 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 27.95% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.49% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 5.72% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.39% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.05% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.38% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 3.70% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.37% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.69% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.02% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.68% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.35% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.35% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.35% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.35% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.35% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.01% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.01% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.01% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.67% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.67% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.34% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.34% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.34% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.34% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.34% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.34% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.34% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.34% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.34% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.34% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.34% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000148 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100m | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003619 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005820 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2 | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300005919 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKM | Environmental | Open in IMG/M |
| 3300005933 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007533 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_D_shore_MG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300019073 | Metatranscriptome of marine microbial communities from Baltic Sea - GS683_0p1 | Environmental | Open in IMG/M |
| 3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019721 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MG | Environmental | Open in IMG/M |
| 3300019728 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_2-3_MG | Environmental | Open in IMG/M |
| 3300019750 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022046 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 (v2) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300022851 | Saline water microbial communities from Ace Lake, Antarctica - #1237 | Environmental | Open in IMG/M |
| 3300022902 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023229 | Saline water microbial communities from Ace Lake, Antarctica - #551 | Environmental | Open in IMG/M |
| 3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
| 3300023242 | Saline water microbial communities from Ace Lake, Antarctica - #1576 | Environmental | Open in IMG/M |
| 3300023294 | Saline water microbial communities from Ace Lake, Antarctica - #732 | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024258 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_120_MG | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025688 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300031227 | Saline water microbial communities from Ace Lake, Antarctica - #232 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031588 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCM | Environmental | Open in IMG/M |
| 3300031596 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCM | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031700 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_surface | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100773604 | 3300000101 | Marine | MEWILLGTIVTIIIVGCWLARSSQDYIDEQNERYRKERDND* |
| DelMOSum2010_101027183 | 3300000101 | Marine | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKDKK* |
| DelMOSum2010_101433382 | 3300000101 | Marine | MEWVLLGTITILIVVGCYMARSSQDYIDEQNERIRQHDKWRNK* |
| DelMOSum2010_101547782 | 3300000101 | Marine | MEWVLXGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTK* |
| DelMOSum2010_101721152 | 3300000101 | Marine | MEWVLLGTITIIIVVGCSLARSSQDYIDEQNERIRQHDKWRNK* |
| DelMOSum2010_101877922 | 3300000101 | Marine | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRRSKK* |
| DelMOSum2010_102130282 | 3300000101 | Marine | MDWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK* |
| DelMOSum2010_102181052 | 3300000101 | Marine | MEWILLGTILIIIVVGCNLAKSNQDYIDEQNERYRRSKK* |
| DelMOSum2010_102377662 | 3300000101 | Marine | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERYRKERDND* |
| DelMOSum2010_102578923 | 3300000101 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNERIRKDEQWRNKQ* |
| DelMOSum2011_100549087 | 3300000115 | Marine | MEWILLGTILIIIVVGCNLAKSNQDYIDEQNERYRRS |
| DelMOSum2011_102075923 | 3300000115 | Marine | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERYRKERDNDXF* |
| DelMOSpr2010_100654063 | 3300000116 | Marine | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKDXK* |
| DelMOSpr2010_101424453 | 3300000116 | Marine | MEYVLLGMIITIIVVGLYFARSSQDYIDEQNARIRQEREDR* |
| DelMOSpr2010_102200393 | 3300000116 | Marine | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNQRYREERKNARTK* |
| DelMOSpr2010_102523192 | 3300000116 | Marine | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRXXKK* |
| SI47jul10_100mDRAFT_10398551 | 3300000148 | Marine | MEWILFGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK* |
| JGI24006J15134_100295731 | 3300001450 | Marine | MEWILLGMIITIIVVGLTFARSTQDYIDEQNQRYR |
| JGI24006J15134_101127284 | 3300001450 | Marine | MEYIFLGMIITVIVVGLWLAKSTQDFVDEQNEKIRKDIR* |
| JGI24006J15134_101372702 | 3300001450 | Marine | MEYIFLGMIITLIVVGLWLAKSTQDFVDDQNERIRKDRK* |
| JGI24006J15134_101444104 | 3300001450 | Marine | MEWVLLGTITILIVVGCYMARSTQDYIDEQNQRYREEKKNARTK* |
| JGI24006J15134_101758361 | 3300001450 | Marine | MEYIFLGIIITLIVVGLWLAKSTQDFVDEQNERYRNDK* |
| JGI24006J15134_101813293 | 3300001450 | Marine | MEWVLLGTITIIIVVGCYMARSTQDYIDEQNKRIRQHDKWRNK* |
| JGI24006J15134_101999032 | 3300001450 | Marine | MEWILLGTCIIIIFVGLKFARSTQDYIDEQNERIRKDIR* |
| JGI24006J15134_102364582 | 3300001450 | Marine | MEYVLLGMIITIIVIGLYFARSSQDYIDEQNARIRQEREDR* |
| JGI24006J15134_102493071 | 3300001450 | Marine | MEYVLLGMIITLIVVGLYFARSTQDYIDEQNERIRQDQKWRDKQ* |
| JGI24006J15134_102527393 | 3300001450 | Marine | LGMIITIIVVGLTFARSTQDYIDEQNQRYREERKNARTK* |
| JGI24003J15210_101048172 | 3300001460 | Marine | MEYIFLGMIITLIVVGLWLAKSTQDFVDXQNERYRNXK* |
| JGI24003J15210_101084501 | 3300001460 | Marine | MEWVFLGMITTLIVVGLSLARSSQDYIDEQNERIRQHDKWRKNND* |
| JGI24003J15210_101124973 | 3300001460 | Marine | MEYIFLGMIITLIVVGLWLAKSTQDFVDEQNEKIRKDIR* |
| JGI24003J15210_101249612 | 3300001460 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREERKNARTK* |
| JGI24003J15210_101383733 | 3300001460 | Marine | IMEWVLLGTITILIVVGCYMARSTQDYIDEQNQRYREEKKNARTK* |
| JGI24003J15210_101435491 | 3300001460 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRNKS* |
| JGI24003J15210_101478812 | 3300001460 | Marine | VTIIIVGCWLARSTQDYIDEQNERYRKERDNDKL* |
| JGI24003J15210_101588481 | 3300001460 | Marine | IIVVGLTFARSTQDYIDEQNERIRQHDKWRKNDTTK* |
| JGI24004J15324_100697265 | 3300001472 | Marine | ESEVIMEWVLLGTITILIVVGCYMARSTQDYIDEQNQRYREEKKNARTK* |
| JGI24004J15324_101025443 | 3300001472 | Marine | MEYIFLGMIITLIVVGLWLAKSTQDFVDEQNERYRNDK* |
| JGI24004J15324_101178741 | 3300001472 | Marine | QLESEVIMEWVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREERKNARTK* |
| JGI24004J15324_101565172 | 3300001472 | Marine | MEWVLLGMITTLIVVGCSLARSSQDYIDEQNERIRQHDKWRNK* |
| JGI24005J15628_101052513 | 3300001589 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRDKQ* |
| JGI24005J15628_102266713 | 3300001589 | Marine | MEWILLGTCIIIIFVGLKFARSTQDYIDEQNERIRKDRK* |
| JGI24513J20088_10121325 | 3300001720 | Marine | LESEVIMEWVLLGMIITIIVVGLTFARSTQDYIDEQNQKYREERKNARTK* |
| JGI24524J20080_10178263 | 3300001853 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNQKYREERKNARTK* |
| JGI26238J51125_11128603 | 3300003478 | Marine | RTIQNCQRQLESEVIMEWVFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK* |
| JGI26380J51729_100967354 | 3300003619 | Marine | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKNARTK* |
| Ga0065861_10491691 | 3300004448 | Marine | MEWILLGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRNK* |
| Ga0068513_10048902 | 3300004951 | Marine Water | MEWAFLGMIITLIVVGLYFARTTQDYIDEQNERYRKERDND* |
| Ga0078747_1504722 | 3300005820 | Marine Sediment | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKEKNNG* |
| Ga0075109_11929392 | 3300005912 | Saline Lake | MEWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK* |
| Ga0075117_12116202 | 3300005914 | Saline Lake | MEWVFLGMITTLIVVGLYFARSTQDYIDEQNERIRQHDKWRNK* |
| Ga0075114_100520643 | 3300005919 | Saline Lake | MEWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKDKK* |
| Ga0075118_102796623 | 3300005933 | Saline Lake | MEWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKE |
| Ga0075474_101159293 | 3300006025 | Aqueous | MEWIFLGMITILIVVGLYFARSTQDYIDEQNERYRRSKK* |
| Ga0075474_102024831 | 3300006025 | Aqueous | SMIITLISVGLFFARSTQDYIDEQNERYRKERDND* |
| Ga0075478_101275563 | 3300006026 | Aqueous | MGSEVLMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKDKK* |
| Ga0075478_102545682 | 3300006026 | Aqueous | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERIRQHDKWRKNNG* |
| Ga0075462_100440013 | 3300006027 | Aqueous | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTK* |
| Ga0075466_11748092 | 3300006029 | Aqueous | VVATKLGFNMEWVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREEKKNARTK* |
| Ga0075441_102578722 | 3300006164 | Marine | MEWILLGTCIIIIVIGLKFARSTQDYIDEQNERYRNDK* |
| Ga0075441_102766733 | 3300006164 | Marine | MEWILLGTCIIVIVVGLKFARSTQDYIDEQNERYRNEK* |
| Ga0075443_102235703 | 3300006165 | Marine | MEWILLGTCIIIIVVGLKFARSTQDYIDEQNERYRNEK* |
| Ga0075446_101491013 | 3300006190 | Marine | MEWILLGTCIIIIFVGLKFARSTQDYIDEQNERYRNDK* |
| Ga0075446_101504593 | 3300006190 | Marine | MEYIFLGMIITLIVVGLWLAKSTQDFVDEQNERIRKDRK* |
| Ga0075511_10877422 | 3300006402 | Aqueous | MEWVFLSMIITLISVGLFFARSTQDYIDEQNERYRKERDND* |
| Ga0070749_104137763 | 3300006802 | Aqueous | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERIRQSEYN |
| Ga0070749_105482982 | 3300006802 | Aqueous | MEWVLLGMITTLIVVGLYFAKSTQEYIDEQNQRYREERKNARTK* |
| Ga0075476_100809994 | 3300006867 | Aqueous | MEWILLGMITTLIVVGLYFARSTQDYIDEQNERYRRSKK* |
| Ga0075476_102632172 | 3300006867 | Aqueous | MEWIFLGMITILIVVGLYFARSTQDYIDEQNERYRKEKNNG* |
| Ga0075481_100812433 | 3300006868 | Aqueous | LLGTIVTIIIVGCWLARSSQDYIDEQNERYRKERDND* |
| Ga0075479_103031771 | 3300006870 | Aqueous | RQLESEVLMEWVFLSMIITLISVGLFFARSTQDYIDEQNERYRKERDND* |
| Ga0075475_103358573 | 3300006874 | Aqueous | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKERNNG* |
| Ga0098045_11486142 | 3300006922 | Marine | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDNAK* |
| Ga0075444_101927232 | 3300006947 | Marine | MEWILLGTCIIIIVVGLKFARSTQDYIDEQNERIRKDRK* |
| Ga0075444_102545492 | 3300006947 | Marine | MEWVLLGTIIILIVVGCYMARSTQDYIDEQNERIRQDQKWRDKQ* |
| Ga0075460_101626562 | 3300007234 | Aqueous | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK* |
| Ga0070752_12806923 | 3300007345 | Aqueous | LESEVVMEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTK* |
| Ga0102944_10796902 | 3300007533 | Pond Soil | MEWAFLGMIITLIVVGLYFARSTQDYIDEQNERYRRSKK* |
| Ga0099848_12167862 | 3300007541 | Aqueous | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKDKK* |
| Ga0102859_12834911 | 3300007708 | Estuarine | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDNDKL* |
| Ga0102951_10661375 | 3300007725 | Water | WAFLVMIITLIVVGLYFARSTQDYIDEQNERYRRSKK* |
| Ga0075480_105403011 | 3300008012 | Aqueous | NSNYNLESEALMEWVLLGTITILIVVGCYMARSTQDYIDEQNERYRKERDND* |
| Ga0114916_11191501 | 3300008221 | Deep Ocean | MILVLIVVGLSFARSTQDYIDEQNDRIRQDQKWRDKK* |
| Ga0102960_11323973 | 3300009000 | Pond Water | MEWAFLGMIITLIVVGLYFARSTQDYIDEQNERYRKERDND* |
| Ga0102963_11618723 | 3300009001 | Pond Water | MESEALMEWIFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK* |
| Ga0102957_14063331 | 3300009027 | Pond Water | MEWVFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKNNDTTK* |
| Ga0102958_11954002 | 3300009035 | Soil | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKERDND* |
| Ga0115566_107243362 | 3300009071 | Pelagic Marine | MEWVLLGTIITIIIVGLTFARSTQDYIDEQNERYRKERDND* |
| Ga0115549_10896934 | 3300009074 | Pelagic Marine | MEWIFLGMIITLIVVGLYFARSTQDYIDEQNERYRKEKK* |
| Ga0115549_11961203 | 3300009074 | Pelagic Marine | MESEALMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDND* |
| Ga0115552_13629373 | 3300009077 | Pelagic Marine | LESEALMEWIFLGMIITLIVVGLYFARSTQDYIDEQNERYRKEKK* |
| Ga0114918_103261352 | 3300009149 | Deep Subsurface | MEWVFFGMITTLIVVGLYFARSTQDYIDEQNERYRKERK* |
| Ga0114995_104172852 | 3300009172 | Marine | MEWILLGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRNKS* |
| Ga0114996_112551193 | 3300009173 | Marine | MEYIFLGMIITLIVVGLWLAKSTQDFVDEQNERYRNEK* |
| Ga0115551_11201932 | 3300009193 | Pelagic Marine | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK* |
| Ga0114993_103200944 | 3300009409 | Marine | MEWILFGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRNK* |
| Ga0114994_104526082 | 3300009420 | Marine | MEYVLLGMIITLIVVGLYFARSTQDYIDEQNQRIRQDQKWRDKQ* |
| Ga0114998_100404006 | 3300009422 | Marine | MEWILFGMITLLIVVGLYFARSTQDYIDEQNERYRKEKK* |
| Ga0114998_102606832 | 3300009422 | Marine | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERIRQHDKWRNK* |
| Ga0114998_103317532 | 3300009422 | Marine | MEYVLLGMIIIIIAVGLYFARSSQDYIDEQNARIRQEREDR* |
| Ga0115548_12132802 | 3300009423 | Pelagic Marine | MEWIFLGMIITLIVVGLYFARSTQDYIDEQNERYRRSKK* |
| Ga0114915_10889785 | 3300009428 | Deep Ocean | EWILLGTCIIIIVVGLKFARSTQDYIDEQNERYRNDK* |
| Ga0115005_107185653 | 3300009432 | Marine | FGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK* |
| Ga0115545_12480482 | 3300009433 | Pelagic Marine | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERIRQHDKWRKNND* |
| Ga0115561_11435653 | 3300009440 | Pelagic Marine | MEWIFLGMIITLIVVGLYFARSTQDYIDEQNERYRKEKNNG* |
| Ga0115007_100729443 | 3300009441 | Marine | MEYVLLGMIVTIIVVGLYFARSSQDYIDEQNERIRQDQKWRDKQ* |
| Ga0114930_102065074 | 3300009499 | Deep Subsurface | QLESEVLMDWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK* |
| Ga0115001_107692511 | 3300009785 | Marine | MEWILLGVIIAIIVVGLTFARSTQDYIDEQNERLRQHDK |
| Ga0136655_10402015 | 3300010316 | Freshwater To Marine Saline Gradient | SEVLMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKDKK* |
| Ga0129324_104341081 | 3300010368 | Freshwater To Marine Saline Gradient | LESEALMDWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKEKNNG* |
| Ga0118731_1152242101 | 3300010392 | Marine | ITTLIVVGLYFARSTQDYIDEQNQRYREERKNARTK* |
| Ga0133547_110813561 | 3300010883 | Marine | SEVIMEWVLLGTITILIVVGCYMARSTQDYIDEQNERIRQHDKWRNK* |
| Ga0114922_116149242 | 3300011118 | Deep Subsurface | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK* |
| Ga0180120_102149202 | 3300017697 | Freshwater To Marine Saline Gradient | MESEALMEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKERNNG |
| Ga0181391_10971202 | 3300017713 | Seawater | MEWVLLGTIITIIIVGLTFARSTQDYIDEQNERYRKERDND |
| Ga0181412_11264563 | 3300017714 | Seawater | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYSKERDNDKLXILLL |
| Ga0181404_10992723 | 3300017717 | Seawater | RNYNMESEALMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNEKYRKERDNDKL |
| Ga0181419_11739231 | 3300017728 | Seawater | TIVTIIIVGCWLARSTQDYIDEQNERYRKERDNDKL |
| Ga0187222_11041733 | 3300017734 | Seawater | LGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDND |
| Ga0181407_10675171 | 3300017753 | Seawater | EALMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNEKYRKERDNDKL |
| Ga0181409_11692243 | 3300017758 | Seawater | MEWVLLGTIIILIVVGCYMARSTQDYIDEQNERYREEKKNARTK |
| Ga0181422_12426931 | 3300017762 | Seawater | ALMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDNDKL |
| Ga0181406_10740891 | 3300017767 | Seawater | YIMESEALMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDND |
| Ga0181406_11083254 | 3300017767 | Seawater | LLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDNDKL |
| Ga0187220_11408093 | 3300017768 | Seawater | LESEVVMEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTK |
| Ga0181423_12675173 | 3300017781 | Seawater | GTIVTIIIVGCWLARSTQDYIDEQNERYRKERDND |
| Ga0188855_10014141 | 3300019073 | Freshwater Lake | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKEKNNGXTKRSTLXNNR |
| Ga0194016_10522323 | 3300019708 | Sediment | MGSEVLMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDND |
| Ga0194011_10328993 | 3300019721 | Sediment | MGSEVLMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKDKK |
| Ga0193996_10140303 | 3300019728 | Sediment | MEWVLLGTIVTIIIVGCWLAKSTQDYIDEQNERYRKERDND |
| Ga0194000_10232081 | 3300019750 | Sediment | LMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDND |
| Ga0194023_10203123 | 3300019756 | Freshwater | MEWVLLGTITILIVVGCYMARSSQDYIDEQNERIRQHDKWRNK |
| Ga0194023_10734963 | 3300019756 | Freshwater | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYR |
| Ga0206131_100080022 | 3300020185 | Seawater | MEWIFLGMITILIVVGLYFARSTQDYIDEQNERYRKEKNNG |
| Ga0206131_102224853 | 3300020185 | Seawater | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRRSKK |
| Ga0211576_106514363 | 3300020438 | Marine | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERYREEKKNARTK |
| Ga0213867_11093673 | 3300021335 | Seawater | LIMEWILLGTIVTIIIVGCWLARSSQDYIDEQNERYRKERDND |
| Ga0213862_102383791 | 3300021347 | Seawater | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKD |
| Ga0206123_101948732 | 3300021365 | Seawater | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDND |
| Ga0213863_100473763 | 3300021371 | Seawater | MEWILLGTIVTIIIVGCWLARSSQDYIDEQNERYRKERDND |
| Ga0222717_102620462 | 3300021957 | Estuarine Water | MEWVFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKNNDTTK |
| Ga0222718_100904873 | 3300021958 | Estuarine Water | MEWVFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK |
| Ga0222715_102549824 | 3300021960 | Estuarine Water | WQLESEVLMEWAFLGMIITLIVVGLYFARSTQDYIDEQNERYRKERDND |
| Ga0222715_106445993 | 3300021960 | Estuarine Water | MEWVFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNART |
| Ga0222719_108263661 | 3300021964 | Estuarine Water | EVIMEWVFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK |
| Ga0224897_1003512 | 3300022046 | Seawater | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDNDKL |
| Ga0212030_10230544 | 3300022053 | Aqueous | SEVLMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKDKK |
| Ga0212030_10252933 | 3300022053 | Aqueous | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTK |
| Ga0212030_10656331 | 3300022053 | Aqueous | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKDK |
| Ga0212024_10619371 | 3300022065 | Aqueous | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERIRPS |
| Ga0212024_10636833 | 3300022065 | Aqueous | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKDKK |
| Ga0212020_10284031 | 3300022167 | Aqueous | FLSMIITLISVGLFFARSTQDYIDEQNERYRKERDND |
| Ga0196903_10447492 | 3300022169 | Aqueous | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKERDND |
| Ga0196887_11137052 | 3300022178 | Aqueous | VLMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDND |
| Ga0196891_10753782 | 3300022183 | Aqueous | MESEALMEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRRSKK |
| Ga0224513_103791341 | 3300022220 | Sediment | YIMEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRRSKK |
| Ga0222646_1242401 | 3300022822 | Saline Water | MEWVFFGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0222691_10423893 | 3300022851 | Saline Water | MEWILFGMITTLIVVGLYFARSTQDYIDEQNERYR |
| Ga0222691_10500602 | 3300022851 | Saline Water | MEWVFLGMITTLIVVGLYFARSTQDYIDEQNERIRQHDKWRNK |
| (restricted) Ga0233429_10283675 | 3300022902 | Seawater | MESEVLMEWILFGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK |
| (restricted) Ga0233412_100961282 | 3300023210 | Seawater | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREEKNARTK |
| (restricted) Ga0233412_101274513 | 3300023210 | Seawater | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKNARTK |
| (restricted) Ga0233412_101825622 | 3300023210 | Seawater | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYRKERDND |
| (restricted) Ga0233412_104002192 | 3300023210 | Seawater | MEWILFGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK |
| Ga0222661_10425513 | 3300023229 | Saline Water | MEWILFGMITTLIVVGLYFARSTQDYIDEQNERYKMEKEKRI |
| Ga0222634_10647151 | 3300023235 | Saline Water | MEWILLGTILIIIVVGCNLARSSQDYIDEQNKRYRE |
| Ga0222708_10572692 | 3300023242 | Saline Water | MEWILFGMITTLIVVGLYFARSTQDYIDEQNERIRQHDKWRNK |
| Ga0222670_10545781 | 3300023294 | Saline Water | MEWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKEK |
| (restricted) Ga0255050_100783422 | 3300024052 | Seawater | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRRSKKND |
| Ga0228655_11080261 | 3300024236 | Seawater | LESEALMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDNDKL |
| (restricted) Ga0233440_10725143 | 3300024258 | Seawater | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTKXRTFXTTRPEQS |
| (restricted) Ga0233437_11780714 | 3300024259 | Seawater | VLMEWVFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK |
| Ga0210003_10426984 | 3300024262 | Deep Subsurface | MEWVLLGTITILIVVGCYMARSTQDYIDEQNQRYREEKKNARTK |
| Ga0210003_10676672 | 3300024262 | Deep Subsurface | MEWVFFGMITTLIVVGLYFARSTQDYIDEQNERIRQHDKWRNK |
| Ga0210003_12768232 | 3300024262 | Deep Subsurface | MEWVFFGMITTLIVVGLYFARSTQDYIDEQNERYRKERK |
| (restricted) Ga0255049_103471531 | 3300024517 | Seawater | IMEWVLLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK |
| (restricted) Ga0255049_105100393 | 3300024517 | Seawater | GMITTLIVVGLYFARSTQDYIDEQNQRYREEKNARTK |
| (restricted) Ga0255048_102170583 | 3300024518 | Seawater | MESEVLMEWILFGMIITIIVVGLTFARSTQDYIDEQNQRYREERKNDTINR |
| (restricted) Ga0255046_103680912 | 3300024519 | Seawater | MEWAFLGMIITLIVVGLYFARTTQDYIDEQNERYRKERDND |
| Ga0207905_10036364 | 3300025048 | Marine | MEWVLLGTITIIIVVGCSLARSSQDYIDEQNERIRQHDKWRNK |
| Ga0207905_10118063 | 3300025048 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREERKNARTK |
| Ga0207905_10157552 | 3300025048 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRNK |
| Ga0207905_10264791 | 3300025048 | Marine | RQLESEVIMEWVLLGMIITIIVVGLTFARSTQDYIDEQNQKYREERKNARTK |
| Ga0207905_10295423 | 3300025048 | Marine | MEWVLLGMITTLIVVGCSLARSSQDYIDEQNERIRQHDKWRNK |
| Ga0207905_10631912 | 3300025048 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRDKQ |
| Ga0207906_10552691 | 3300025052 | Marine | VLLGTITIIIVVGCSLARSSQDYIDEQNERIRQHDKWRNK |
| Ga0207896_10348464 | 3300025071 | Marine | MEYIFLGMIITLIVVGLWLAKSTQDFVDEQNERYRNEK |
| Ga0207896_10562692 | 3300025071 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRNKS |
| Ga0207896_10567842 | 3300025071 | Marine | MEYIFLGMIITLIVVGLWLAKSTQDFVDEQNEKIRKDIR |
| Ga0207890_10039435 | 3300025079 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNQKYREERKNARTK |
| Ga0207890_10372884 | 3300025079 | Marine | ITTLIVVGCSLARSSQDYIDEQNERIRQHDKWRNK |
| Ga0208157_10828533 | 3300025086 | Marine | MEWVLLGTITTIIIVGCWLARSTQDYIDEQNERLRKDQKWRDRNNG |
| Ga0208158_10371163 | 3300025110 | Marine | MESEALMEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERYRKERDND |
| Ga0209535_10054043 | 3300025120 | Marine | MDWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0209535_10352595 | 3300025120 | Marine | LESEVIMEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTK |
| Ga0209535_10673035 | 3300025120 | Marine | MITTLIVVGCSLARSSQDYIDEQNERIRQHDKWRNK |
| Ga0209535_10817063 | 3300025120 | Marine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNERYREEKKNARTK |
| Ga0209535_10855141 | 3300025120 | Marine | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNA |
| Ga0209535_10986232 | 3300025120 | Marine | MEYVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREEKK |
| Ga0209535_11462021 | 3300025120 | Marine | MIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRKNDTTK |
| Ga0209535_12227862 | 3300025120 | Marine | MEYVLLGMIITIIVVGLYFARSSQDYIDEQNARIRQEREDR |
| Ga0209232_10628971 | 3300025132 | Marine | MEWILLGTIVTIIIVGCWLARSTQDYIDEQNERYRK |
| Ga0209336_101128864 | 3300025137 | Marine | MEYIFLGMIITLIVVGLWLAKSTQDFVDDQNERIRKDRK |
| Ga0209634_10095576 | 3300025138 | Marine | MEWILLGMIITIIVVGLTFARSTQDYIDEQNQRYREERKNARTK |
| Ga0209634_11588862 | 3300025138 | Marine | MEYIFLGIIITLIVVGLWLAKSTQDFVDEQNERYRNDK |
| Ga0209634_11970733 | 3300025138 | Marine | MEWILLGTCIIIIFVGLKFARSTQDYIDEQNERIRKDRK |
| Ga0209337_10602264 | 3300025168 | Marine | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYRRSKK |
| Ga0209337_10606832 | 3300025168 | Marine | MEWVLLGTITIIIVVGCSLARSSQEHIDYMNDRIRQDQKWRDKQXHN |
| Ga0209337_11217344 | 3300025168 | Marine | RQLESEVIMEWVLLGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRNKS |
| Ga0209337_11345883 | 3300025168 | Marine | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERIRQHDKWRNK |
| Ga0209337_12068564 | 3300025168 | Marine | SEVIMEWVLLGTITIIIVVGCSLARSSQDYIDEQNERIRQHDKWRNK |
| Ga0208031_10305952 | 3300025237 | Deep Ocean | MEWVLLGTIIILIVVGCYMARSTQDYIDEQNERIRQDQKWRDKQ |
| Ga0208148_10524293 | 3300025508 | Aqueous | VVATKLGFNMEWVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREEKKNARTK |
| Ga0208148_10666133 | 3300025508 | Aqueous | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERYRKERDND |
| Ga0209195_10518662 | 3300025590 | Pelagic Marine | MEWIFLGMIITLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0209716_11376193 | 3300025626 | Pelagic Marine | MEWIFLGMITILIVVGLYFARSTQDYIDEQNERYRKEKNN |
| Ga0208643_10122331 | 3300025645 | Aqueous | ESEALMEWVLLGTITILIVVGCYMARSTQDYIDEQNERYRKERDND |
| Ga0208643_11710453 | 3300025645 | Aqueous | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERYRK |
| Ga0208134_11185953 | 3300025652 | Aqueous | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTKXRTLXTNR |
| Ga0208134_11591232 | 3300025652 | Aqueous | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKEKNNG |
| Ga0208428_10505373 | 3300025653 | Aqueous | MEWVFLSMIITLISVGLFFARSTQDYIDEQNERYRKERDND |
| Ga0208898_10539724 | 3300025671 | Aqueous | MEWILLGMITTLIVVGLYFARSTQDYIDEQNERYRRSKK |
| Ga0208898_11844261 | 3300025671 | Aqueous | MEWIFLGMITILIVVGLYFARSTQDYIDEQNERYRRSKK |
| Ga0209140_11572812 | 3300025688 | Marine | MEWILFGMITTLIVVGLYFARSTQDYIDEQNQRYREEKNARTK |
| Ga0208899_11780684 | 3300025759 | Aqueous | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRR |
| Ga0208425_10819113 | 3300025803 | Aqueous | SMIITLISVGLFFARSTQDYIDEQNERYRKERDND |
| Ga0208542_10071388 | 3300025818 | Aqueous | MGSEVLMEWVLLGTIVTIIIVGCWLARSTQDYIDE |
| Ga0208917_12642752 | 3300025840 | Aqueous | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKERNNG |
| Ga0208645_12075633 | 3300025853 | Aqueous | RQLESEVLMEWVFLSMIITLISVGLFFARSTQDYIDEQNERYRKERDND |
| Ga0208645_12777002 | 3300025853 | Aqueous | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNERIRKDEQWRNKQ |
| Ga0209951_11284652 | 3300026138 | Pond Water | MEWAFLGMIITLIVVGLYFARSTQDYIDEQNERYRKERDND |
| Ga0209384_10209063 | 3300027522 | Marine | MEWILLGTCIIIIVVGLKFARSTQDYIDEQNERIRKDRK |
| Ga0209384_10291814 | 3300027522 | Marine | MEWILLGTCIIIIVVGLKFARSTQDYIDEQNERYRNDK |
| Ga0209384_10699052 | 3300027522 | Marine | MEWILLGTCIIIIFVGLKFARSTQDYIDEQNERYRNDK |
| Ga0209383_11065555 | 3300027672 | Marine | GYKIMEWILLGTCIIIIVVGLKFARSTQDYIDEQNDRYRNDK |
| Ga0209710_10318584 | 3300027687 | Marine | MEWILFGMITLLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0209710_11553382 | 3300027687 | Marine | MEYVLLGMIIIIIAVGLYFARSSQDYIDEQNARIRQEREDR |
| Ga0209816_10384451 | 3300027704 | Marine | MVIEGWLFFAMILVLIVVGLKFARSTQDYVDEQNER |
| Ga0209711_104307931 | 3300027788 | Marine | WILFGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0209302_101592862 | 3300027810 | Marine | MEYVLLGMIVTIIVVGLYFARSSQDYIDEQNERIRQDQKWRDKQ |
| Ga0209090_102863282 | 3300027813 | Marine | MEYVLLGMIIIIIAVGLYFARSSQDYIDEQNARYLEAKE |
| (restricted) Ga0255054_102014924 | 3300027856 | Seawater | MEWVFLGMITTLIVVGLSLARSSQDYIDEQNERIRQHDKWRKNND |
| (restricted) Ga0255054_105438962 | 3300027856 | Seawater | MESEVLMEWILFGMITTLIVVGLYFARSTQDYIDEQNERIRQHDKWRKNND |
| (restricted) Ga0233415_103394384 | 3300027861 | Seawater | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERIRQHDKW |
| (restricted) Ga0255055_101548395 | 3300027881 | Seawater | FLGMITTLIVVGLYFARSTQDYIDEQNERYRRSKK |
| Ga0256368_10197083 | 3300028125 | Sea-Ice Brine | MEWVLLGMIIIIIGVGLTFARSTQDYIDEQNQRYREERKNARTK |
| Ga0256368_10234802 | 3300028125 | Sea-Ice Brine | MEWVLFGMIITIIVVGLTFARSTQDYIDEQNERLRQHDKWRNK |
| Ga0256368_10282243 | 3300028125 | Sea-Ice Brine | MEWILFGMIITLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0256368_10372621 | 3300028125 | Sea-Ice Brine | LESEVIMEWVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREERKNARTK |
| Ga0256368_10454001 | 3300028125 | Sea-Ice Brine | MEYVLLGMIITIIAVGLYFARSNQDYIDEQNARYLE |
| Ga0256368_10557323 | 3300028125 | Sea-Ice Brine | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERYREEKKNARTKXRTLXINR |
| Ga0256368_10593221 | 3300028125 | Sea-Ice Brine | MEWILFGMITILIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0256368_10859702 | 3300028125 | Sea-Ice Brine | MESEVLMEWVFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK |
| Ga0257114_10690925 | 3300028196 | Marine | MEWILFGMITTLIVVGLYFARSTQDYIDEQNERYRRSKK |
| Ga0307928_100783481 | 3300031227 | Saline Water | LMEWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0307488_102292243 | 3300031519 | Sackhole Brine | MEWILLGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRNK |
| Ga0307488_102765532 | 3300031519 | Sackhole Brine | MEYVLLGMIITLIVVGLYFARSTQDYIDEQNQRIRQDQKWRDKQ |
| Ga0307488_103141471 | 3300031519 | Sackhole Brine | QLESEVIMEWVLLGTITILIVVGCYMARSTQDYIDEQNQRYREEKKNARTK |
| Ga0307488_103654014 | 3300031519 | Sackhole Brine | MEWILFGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRKNND |
| Ga0307488_103813222 | 3300031519 | Sackhole Brine | MEWILLGTITIIIVVGCSLARSSQDYIDEQNERIRQHDKWRNK |
| Ga0307488_103941352 | 3300031519 | Sackhole Brine | MEWVLLGMIITLIVVGLTFARSTQDYIDEQNQRYREERKNARTK |
| Ga0307488_105098033 | 3300031519 | Sackhole Brine | MDWILFSMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0307488_105341992 | 3300031519 | Sackhole Brine | MEWVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREEKKNARTK |
| Ga0307488_105580741 | 3300031519 | Sackhole Brine | MEWILLGMIITIIVVGLTFARSTQDYIDEQNERLRQHDKWRNK |
| Ga0307488_106173961 | 3300031519 | Sackhole Brine | MEYVLLGMIITIIVVGLYFARSSQDYIDEQNARYLEAKEDRSKYRAL |
| Ga0307488_106585703 | 3300031519 | Sackhole Brine | VVATRLGFNMEWVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREEKK |
| Ga0307488_106947411 | 3300031519 | Sackhole Brine | GTITIIIVVGCSLARSSQDYIDEQNERIRQHDKWRNK |
| Ga0307488_107230541 | 3300031519 | Sackhole Brine | IQNCQRQLESEVLMEWILFGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK |
| Ga0307488_107244851 | 3300031519 | Sackhole Brine | MEWILFGMIVTIIVVGLTFARSTQDYIDEQNERYRKEKK |
| Ga0307488_107434363 | 3300031519 | Sackhole Brine | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTKXRSLXTNR |
| Ga0307488_108474771 | 3300031519 | Sackhole Brine | MEWILLGMITTLIVVGLTFARSTQDYIDEQNERIRQHDKWRNK |
| Ga0307380_102341494 | 3300031539 | Soil | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTK |
| Ga0307380_110130903 | 3300031539 | Soil | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0307378_113387813 | 3300031566 | Soil | MEWVFLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKNARTKXRTFXTTRP |
| Ga0307489_100415545 | 3300031569 | Sackhole Brine | MEWILLGMIITIIVVGCSLARSSQDYIDEQNERIRQHDKWRNK |
| Ga0302137_10788725 | 3300031588 | Marine | ESEVIMEWVLLGMIITIIVVGLTFARSTQDYIDERNQRYREEKKNARTK |
| Ga0302137_12115913 | 3300031588 | Marine | MEWILLGMIITIIVVGLTFARSTQDYIDEQNERIR |
| Ga0302134_101345672 | 3300031596 | Marine | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0302134_101738563 | 3300031596 | Marine | MEWILFGMIITIIVVGLTFARSTQDYIDEQNERIRQHDKWRNK |
| Ga0302132_104313891 | 3300031605 | Marine | HRNEVLMEWILLGMIITIIVVGLTFARSTQDYIDEQNQRYREERKNARTK |
| Ga0302114_101847261 | 3300031621 | Marine | MDWILFGMITTLIVVGLYFARSTQDYIDEQNERIRQHDKWRNK |
| Ga0302118_104581971 | 3300031627 | Marine | SEVIMEYVLLGMIITIIVVGLTFARSTQDYIDEQNQRYREERKNARTK |
| Ga0307984_11494773 | 3300031658 | Marine | MESEVLMEWILFGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0307375_101332225 | 3300031669 | Soil | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNQRYREEKKKCQN |
| Ga0307377_105708911 | 3300031673 | Soil | GELMEWIFLGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0302130_10285891 | 3300031700 | Marine | KRYQRGLVMEWILFGMITLLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0316198_103717663 | 3300032251 | Sediment | MEWIFLGMITILIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0316208_11130123 | 3300032254 | Microbial Mat | MDWILFGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTK |
| Ga0316205_102780972 | 3300032257 | Microbial Mat | MEWVLLGMITTLIVVGLYFARSTQDYIDEQNQRYREERKNARTK |
| Ga0316203_12302743 | 3300032274 | Microbial Mat | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERIRQS |
| Ga0316202_102850742 | 3300032277 | Microbial Mat | VVATKLGFNMEWVLLGMIITIIVVGLTFARSTQDYIDEQNERIRKDEQWRNKQ |
| Ga0314858_037135_2_154 | 3300033742 | Sea-Ice Brine | MESEVIMEWVLLGMIITIIVVGLTFARSTQDYINEQNQRYREERKNDTTN |
| Ga0314858_059149_264_401 | 3300033742 | Sea-Ice Brine | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERIRQHDKWRKNND |
| Ga0314858_128771_399_518 | 3300033742 | Sea-Ice Brine | MEWVFLGMITTLIVVGLYFARSTQDYIDEQNERYRKEKK |
| Ga0348335_089338_893_1009 | 3300034374 | Aqueous | MEWVLLGTIVTIIIVGCWLARSTQDYIDEQNERIRQSEY |
| Ga0348336_023295_1448_1585 | 3300034375 | Aqueous | MEWVLLGTITILIVVGCYMARSTQDYIDEQNERIRQHDKWRKNNG |
| Ga0348336_094418_255_389 | 3300034375 | Aqueous | MEWIFLGMITTLIVVGLYFARSTQDYIDEQNQRYREERKNARTK |
| Ga0348336_153225_557_682 | 3300034375 | Aqueous | VLLGMITTLIVVGLYFARSTQDYIDEQNERYREEKKNARTK |
| ⦗Top⦘ |