| Basic Information | |
|---|---|
| Family ID | F006002 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 384 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISATEEEE |
| Number of Associated Samples | 214 |
| Number of Associated Scaffolds | 384 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.36 % |
| % of genes near scaffold ends (potentially truncated) | 33.59 % |
| % of genes from short scaffolds (< 2000 bps) | 70.83 % |
| Associated GOLD sequencing projects | 178 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.021 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (15.104 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.188 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (84.635 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.56% β-sheet: 8.33% Coil/Unstructured: 86.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 384 Family Scaffolds |
|---|---|---|
| PF14550 | Peptidase_S78_2 | 46.09 |
| PF04860 | Phage_portal | 3.39 |
| PF04466 | Terminase_3 | 1.04 |
| PF13481 | AAA_25 | 0.52 |
| PF00041 | fn3 | 0.52 |
| PF11351 | GTA_holin_3TM | 0.52 |
| PF08291 | Peptidase_M15_3 | 0.26 |
| PF11325 | DUF3127 | 0.26 |
| PF08299 | Bac_DnaA_C | 0.26 |
| PF00589 | Phage_integrase | 0.26 |
| PF10145 | PhageMin_Tail | 0.26 |
| COG ID | Name | Functional Category | % Frequency in 384 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 1.04 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.02 % |
| All Organisms | root | All Organisms | 36.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10020184 | Not Available | 3909 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10026306 | Not Available | 3278 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10029436 | Not Available | 3044 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10045114 | All Organisms → Viruses → Predicted Viral | 2257 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10045715 | All Organisms → Viruses → Predicted Viral | 2237 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10046226 | All Organisms → Viruses → Predicted Viral | 2218 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10067388 | Not Available | 1672 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10089595 | Not Available | 1323 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10252064 | Not Available | 555 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10254274 | Not Available | 551 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10257010 | Not Available | 546 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10024261 | All Organisms → Viruses → Predicted Viral | 2806 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10176670 | Not Available | 611 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10193328 | Not Available | 571 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10196701 | Not Available | 564 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10230596 | Not Available | 501 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10002598 | Not Available | 10489 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10063401 | All Organisms → Viruses → Predicted Viral | 1541 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10070958 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10085843 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10114879 | Not Available | 984 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10125032 | Not Available | 921 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10174197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10223437 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 589 | Open in IMG/M |
| 3300000119|KGI_S1_ANT01_95mDRAFT_c10125469 | Not Available | 721 | Open in IMG/M |
| 3300000121|TDF_OR_ARG04_113mDRAFT_c1003447 | Not Available | 2289 | Open in IMG/M |
| 3300000127|SA_S1_NOR05_45mDRAFT_c10006273 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 3756 | Open in IMG/M |
| 3300000127|SA_S1_NOR05_45mDRAFT_c10009876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2992 | Open in IMG/M |
| 3300000127|SA_S1_NOR05_45mDRAFT_c10135453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300000128|SA_S1_NOR08_45mDRAFT_c10032092 | Not Available | 2119 | Open in IMG/M |
| 3300000128|SA_S1_NOR08_45mDRAFT_c10035510 | Not Available | 1982 | Open in IMG/M |
| 3300000128|SA_S1_NOR08_45mDRAFT_c10081088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
| 3300000130|SA_S2_NOR15_50mDRAFT_c10099039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1056 | Open in IMG/M |
| 3300000243|SA_S2_NOR18_50mDRAFT_1021317 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300000270|HuiMet_100465 | All Organisms → Viruses → Predicted Viral | 4281 | Open in IMG/M |
| 3300000928|OpTDRAFT_10032890 | All Organisms → Viruses → Predicted Viral | 2114 | Open in IMG/M |
| 3300000949|BBAY94_10107699 | Not Available | 762 | Open in IMG/M |
| 3300001344|JGI20152J14361_10056626 | Not Available | 986 | Open in IMG/M |
| 3300001348|JGI20154J14316_10052775 | All Organisms → Viruses → Predicted Viral | 1699 | Open in IMG/M |
| 3300001351|JGI20153J14318_10020186 | All Organisms → Viruses → Predicted Viral | 3199 | Open in IMG/M |
| 3300001351|JGI20153J14318_10029692 | All Organisms → Viruses → Predicted Viral | 2376 | Open in IMG/M |
| 3300001351|JGI20153J14318_10049307 | Not Available | 1548 | Open in IMG/M |
| 3300001351|JGI20153J14318_10109499 | Not Available | 742 | Open in IMG/M |
| 3300002144|M2t2BS2_10383239 | All Organisms → Viruses → Predicted Viral | 4739 | Open in IMG/M |
| 3300002144|M2t2BS2_10732458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 15659 | Open in IMG/M |
| 3300002186|JGI24539J26755_10095309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
| 3300002674|Ga0005252J37289_101078 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
| 3300003427|JGI26084J50262_1003789 | Not Available | 7315 | Open in IMG/M |
| 3300003427|JGI26084J50262_1016771 | Not Available | 2468 | Open in IMG/M |
| 3300003580|JGI26260J51721_1016895 | Not Available | 1632 | Open in IMG/M |
| 3300003580|JGI26260J51721_1017605 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300003580|JGI26260J51721_1040410 | Not Available | 774 | Open in IMG/M |
| 3300003580|JGI26260J51721_1071738 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 504 | Open in IMG/M |
| 3300003621|JGI26083J51738_10007344 | All Organisms → Viruses → Predicted Viral | 4804 | Open in IMG/M |
| 3300004097|Ga0055584_100873771 | Not Available | 941 | Open in IMG/M |
| 3300004097|Ga0055584_101209685 | Not Available | 788 | Open in IMG/M |
| 3300004097|Ga0055584_102651801 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 503 | Open in IMG/M |
| 3300004279|Ga0066605_10089492 | Not Available | 1299 | Open in IMG/M |
| 3300004279|Ga0066605_10094958 | All Organisms → Viruses → Predicted Viral | 1249 | Open in IMG/M |
| 3300004448|Ga0065861_1008834 | Not Available | 1311 | Open in IMG/M |
| 3300004448|Ga0065861_1026742 | Not Available | 948 | Open in IMG/M |
| 3300004448|Ga0065861_1049172 | Not Available | 570 | Open in IMG/M |
| 3300004448|Ga0065861_1092619 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 986 | Open in IMG/M |
| 3300004457|Ga0066224_1024655 | Not Available | 1001 | Open in IMG/M |
| 3300004460|Ga0066222_1049873 | Not Available | 1393 | Open in IMG/M |
| 3300004461|Ga0066223_1264314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300004642|Ga0066612_1033575 | All Organisms → Viruses → Predicted Viral | 1318 | Open in IMG/M |
| 3300005588|Ga0070728_10480185 | Not Available | 652 | Open in IMG/M |
| 3300005612|Ga0070723_10012893 | Not Available | 2836 | Open in IMG/M |
| 3300005747|Ga0076924_1194570 | Not Available | 937 | Open in IMG/M |
| 3300006027|Ga0075462_10050182 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300006029|Ga0075466_1013490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Nonlabens virus P12024L | 2747 | Open in IMG/M |
| 3300006029|Ga0075466_1022574 | All Organisms → Viruses → Predicted Viral | 2026 | Open in IMG/M |
| 3300006029|Ga0075466_1062338 | All Organisms → Viruses → Predicted Viral | 1072 | Open in IMG/M |
| 3300006029|Ga0075466_1089901 | Not Available | 845 | Open in IMG/M |
| 3300006029|Ga0075466_1118336 | Not Available | 704 | Open in IMG/M |
| 3300006029|Ga0075466_1189648 | Not Available | 513 | Open in IMG/M |
| 3300006029|Ga0075466_1192557 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 508 | Open in IMG/M |
| 3300006164|Ga0075441_10025315 | All Organisms → Viruses → Predicted Viral | 2432 | Open in IMG/M |
| 3300006164|Ga0075441_10034734 | Not Available | 2039 | Open in IMG/M |
| 3300006164|Ga0075441_10047041 | Not Available | 1719 | Open in IMG/M |
| 3300006164|Ga0075441_10055071 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300006164|Ga0075441_10058911 | All Organisms → Viruses → Predicted Viral | 1511 | Open in IMG/M |
| 3300006164|Ga0075441_10094930 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
| 3300006164|Ga0075441_10100887 | Not Available | 1107 | Open in IMG/M |
| 3300006164|Ga0075441_10222926 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300006165|Ga0075443_10100022 | Not Available | 999 | Open in IMG/M |
| 3300006467|Ga0099972_10012568 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
| 3300006484|Ga0070744_10046718 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1271 | Open in IMG/M |
| 3300006484|Ga0070744_10210964 | Not Available | 551 | Open in IMG/M |
| 3300006622|Ga0101442_127334 | All Organisms → Viruses → Predicted Viral | 2080 | Open in IMG/M |
| 3300006752|Ga0098048_1011448 | All Organisms → Viruses → Predicted Viral | 3119 | Open in IMG/M |
| 3300006752|Ga0098048_1064108 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300006752|Ga0098048_1189057 | Not Available | 609 | Open in IMG/M |
| 3300006789|Ga0098054_1140256 | Not Available | 895 | Open in IMG/M |
| 3300006803|Ga0075467_10120205 | Not Available | 1541 | Open in IMG/M |
| 3300006803|Ga0075467_10187705 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300006803|Ga0075467_10408229 | Not Available | 706 | Open in IMG/M |
| 3300006803|Ga0075467_10423739 | Not Available | 690 | Open in IMG/M |
| 3300006803|Ga0075467_10557631 | Not Available | 587 | Open in IMG/M |
| 3300006810|Ga0070754_10194828 | Not Available | 947 | Open in IMG/M |
| 3300006850|Ga0075491_1469293 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300006920|Ga0070748_1063439 | Not Available | 1449 | Open in IMG/M |
| 3300006920|Ga0070748_1138775 | Not Available | 909 | Open in IMG/M |
| 3300006920|Ga0070748_1167926 | Not Available | 811 | Open in IMG/M |
| 3300006920|Ga0070748_1333115 | Not Available | 537 | Open in IMG/M |
| 3300006947|Ga0075444_10022201 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3270 | Open in IMG/M |
| 3300006947|Ga0075444_10219389 | Not Available | 760 | Open in IMG/M |
| 3300006947|Ga0075444_10364258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300006990|Ga0098046_1063663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300007229|Ga0075468_10156380 | Not Available | 687 | Open in IMG/M |
| 3300007276|Ga0070747_1143504 | Not Available | 861 | Open in IMG/M |
| 3300007276|Ga0070747_1250558 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 615 | Open in IMG/M |
| 3300007540|Ga0099847_1000767 | Not Available | 10964 | Open in IMG/M |
| 3300007540|Ga0099847_1011850 | Not Available | 2879 | Open in IMG/M |
| 3300007540|Ga0099847_1039381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1504 | Open in IMG/M |
| 3300007540|Ga0099847_1092665 | Not Available | 924 | Open in IMG/M |
| 3300007540|Ga0099847_1191621 | Not Available | 598 | Open in IMG/M |
| 3300007542|Ga0099846_1101974 | Not Available | 1056 | Open in IMG/M |
| 3300007543|Ga0102853_1068867 | Not Available | 637 | Open in IMG/M |
| 3300007555|Ga0102817_1103241 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 627 | Open in IMG/M |
| 3300007661|Ga0102866_1109801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C101 | 688 | Open in IMG/M |
| 3300007708|Ga0102859_1022675 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
| 3300008221|Ga0114916_1009456 | All Organisms → Viruses → Predicted Viral | 3918 | Open in IMG/M |
| 3300008961|Ga0102887_1245601 | Not Available | 541 | Open in IMG/M |
| 3300009074|Ga0115549_1027696 | All Organisms → Viruses → Predicted Viral | 2169 | Open in IMG/M |
| 3300009074|Ga0115549_1042784 | Not Available | 1650 | Open in IMG/M |
| 3300009074|Ga0115549_1049069 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1512 | Open in IMG/M |
| 3300009074|Ga0115549_1091680 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300009074|Ga0115549_1220235 | Not Available | 604 | Open in IMG/M |
| 3300009076|Ga0115550_1132053 | Not Available | 889 | Open in IMG/M |
| 3300009076|Ga0115550_1154596 | Not Available | 799 | Open in IMG/M |
| 3300009076|Ga0115550_1163392 | Not Available | 770 | Open in IMG/M |
| 3300009076|Ga0115550_1171231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300009076|Ga0115550_1227241 | Not Available | 619 | Open in IMG/M |
| 3300009076|Ga0115550_1261925 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 563 | Open in IMG/M |
| 3300009076|Ga0115550_1262508 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 562 | Open in IMG/M |
| 3300009079|Ga0102814_10498114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300009079|Ga0102814_10742878 | Not Available | 540 | Open in IMG/M |
| 3300009172|Ga0114995_10038092 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2786 | Open in IMG/M |
| 3300009172|Ga0114995_10209942 | Not Available | 1080 | Open in IMG/M |
| 3300009423|Ga0115548_1163065 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 699 | Open in IMG/M |
| 3300009428|Ga0114915_1136147 | Not Available | 706 | Open in IMG/M |
| 3300009428|Ga0114915_1173849 | Not Available | 602 | Open in IMG/M |
| 3300009432|Ga0115005_10395330 | Not Available | 1096 | Open in IMG/M |
| 3300009432|Ga0115005_10410479 | Not Available | 1074 | Open in IMG/M |
| 3300009432|Ga0115005_10879431 | Not Available | 723 | Open in IMG/M |
| 3300009434|Ga0115562_1311957 | Not Available | 537 | Open in IMG/M |
| 3300009435|Ga0115546_1339347 | Not Available | 511 | Open in IMG/M |
| 3300009436|Ga0115008_10280284 | Not Available | 1184 | Open in IMG/M |
| 3300009436|Ga0115008_10444417 | Not Available | 922 | Open in IMG/M |
| 3300009436|Ga0115008_11419889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300009438|Ga0115559_1009930 | Not Available | 5236 | Open in IMG/M |
| 3300009440|Ga0115561_1098666 | Not Available | 1202 | Open in IMG/M |
| 3300009441|Ga0115007_10219740 | Not Available | 1227 | Open in IMG/M |
| 3300009442|Ga0115563_1029470 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2847 | Open in IMG/M |
| 3300009442|Ga0115563_1215400 | Not Available | 731 | Open in IMG/M |
| 3300009447|Ga0115560_1270254 | Not Available | 650 | Open in IMG/M |
| 3300009467|Ga0115565_10204923 | Not Available | 908 | Open in IMG/M |
| 3300009495|Ga0115571_1018372 | All Organisms → Viruses → Predicted Viral | 3629 | Open in IMG/M |
| 3300009505|Ga0115564_10424064 | Not Available | 647 | Open in IMG/M |
| 3300009505|Ga0115564_10627212 | Not Available | 505 | Open in IMG/M |
| 3300009507|Ga0115572_10065150 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2260 | Open in IMG/M |
| 3300009507|Ga0115572_10417085 | Not Available | 750 | Open in IMG/M |
| 3300009526|Ga0115004_10945784 | Not Available | 515 | Open in IMG/M |
| 3300009544|Ga0115006_10259831 | Not Available | 1527 | Open in IMG/M |
| 3300009544|Ga0115006_11233368 | Not Available | 670 | Open in IMG/M |
| 3300009544|Ga0115006_11815710 | Not Available | 558 | Open in IMG/M |
| 3300009606|Ga0115102_10498892 | Not Available | 574 | Open in IMG/M |
| 3300009606|Ga0115102_10872826 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 8770 | Open in IMG/M |
| 3300009606|Ga0115102_10900471 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1583 | Open in IMG/M |
| 3300009785|Ga0115001_10467890 | Not Available | 781 | Open in IMG/M |
| 3300010150|Ga0098056_1033979 | Not Available | 1789 | Open in IMG/M |
| 3300010316|Ga0136655_1056343 | Not Available | 1221 | Open in IMG/M |
| 3300010392|Ga0118731_100621254 | Not Available | 903 | Open in IMG/M |
| 3300010430|Ga0118733_102465947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
| 3300010883|Ga0133547_12106862 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300010883|Ga0133547_12150081 | Not Available | 1015 | Open in IMG/M |
| 3300011126|Ga0151654_1015030 | Not Available | 562 | Open in IMG/M |
| 3300011254|Ga0151675_1035136 | Not Available | 890 | Open in IMG/M |
| 3300012516|Ga0129325_1081457 | Not Available | 1159 | Open in IMG/M |
| 3300013010|Ga0129327_10400434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300013101|Ga0164313_10097957 | Not Available | 2473 | Open in IMG/M |
| 3300013101|Ga0164313_11187893 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 618 | Open in IMG/M |
| 3300017748|Ga0181393_1029277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1569 | Open in IMG/M |
| 3300017762|Ga0181422_1244349 | Not Available | 532 | Open in IMG/M |
| 3300017786|Ga0181424_10000379 | All Organisms → Viruses | 20203 | Open in IMG/M |
| 3300017786|Ga0181424_10124596 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300018569|Ga0188844_100747 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2445 | Open in IMG/M |
| 3300019122|Ga0188839_1031299 | Not Available | 524 | Open in IMG/M |
| 3300020165|Ga0206125_10010337 | Not Available | 6660 | Open in IMG/M |
| 3300020165|Ga0206125_10071942 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300020165|Ga0206125_10239691 | Not Available | 693 | Open in IMG/M |
| 3300020165|Ga0206125_10245232 | Not Available | 683 | Open in IMG/M |
| 3300020165|Ga0206125_10309393 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 589 | Open in IMG/M |
| 3300020166|Ga0206128_1258467 | Not Available | 637 | Open in IMG/M |
| 3300020166|Ga0206128_1259596 | Not Available | 635 | Open in IMG/M |
| 3300020169|Ga0206127_1015602 | Not Available | 5133 | Open in IMG/M |
| 3300020169|Ga0206127_1126156 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1028 | Open in IMG/M |
| 3300020169|Ga0206127_1232189 | Not Available | 649 | Open in IMG/M |
| 3300020185|Ga0206131_10002018 | Not Available | 25249 | Open in IMG/M |
| 3300020185|Ga0206131_10027818 | All Organisms → Viruses → Predicted Viral | 4367 | Open in IMG/M |
| 3300020187|Ga0206130_10000608 | Not Available | 58751 | Open in IMG/M |
| 3300020187|Ga0206130_10124007 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1431 | Open in IMG/M |
| 3300020187|Ga0206130_10322318 | Not Available | 655 | Open in IMG/M |
| 3300020263|Ga0211679_1040216 | Not Available | 846 | Open in IMG/M |
| 3300020347|Ga0211504_1012300 | All Organisms → Viruses → Predicted Viral | 2513 | Open in IMG/M |
| 3300020352|Ga0211505_1081125 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 779 | Open in IMG/M |
| 3300020389|Ga0211680_10024425 | All Organisms → Viruses → Predicted Viral | 3048 | Open in IMG/M |
| 3300020389|Ga0211680_10047259 | All Organisms → Viruses | 1988 | Open in IMG/M |
| 3300020595|Ga0206126_10045012 | Not Available | 2461 | Open in IMG/M |
| 3300020595|Ga0206126_10058486 | Not Available | 2049 | Open in IMG/M |
| 3300021085|Ga0206677_10010395 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 6491 | Open in IMG/M |
| 3300021185|Ga0206682_10057447 | All Organisms → Viruses → Predicted Viral | 2086 | Open in IMG/M |
| 3300021185|Ga0206682_10275193 | Not Available | 740 | Open in IMG/M |
| 3300021350|Ga0206692_1638880 | Not Available | 676 | Open in IMG/M |
| 3300021373|Ga0213865_10345843 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 677 | Open in IMG/M |
| 3300021375|Ga0213869_10000469 | Not Available | 33349 | Open in IMG/M |
| 3300021389|Ga0213868_10085089 | Not Available | 2074 | Open in IMG/M |
| 3300021389|Ga0213868_10379983 | Not Available | 786 | Open in IMG/M |
| 3300021957|Ga0222717_10004252 | Not Available | 10602 | Open in IMG/M |
| 3300021957|Ga0222717_10028803 | Not Available | 3680 | Open in IMG/M |
| 3300021957|Ga0222717_10565945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300021959|Ga0222716_10056483 | All Organisms → Viruses → Predicted Viral | 2765 | Open in IMG/M |
| 3300021959|Ga0222716_10639217 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 574 | Open in IMG/M |
| 3300021959|Ga0222716_10731847 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 521 | Open in IMG/M |
| 3300022050|Ga0196883_1005041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
| 3300022053|Ga0212030_1007052 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1315 | Open in IMG/M |
| 3300022053|Ga0212030_1009743 | Not Available | 1178 | Open in IMG/M |
| 3300022053|Ga0212030_1035413 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 700 | Open in IMG/M |
| 3300022053|Ga0212030_1055270 | Not Available | 564 | Open in IMG/M |
| 3300022053|Ga0212030_1064647 | Not Available | 521 | Open in IMG/M |
| 3300022061|Ga0212023_1000198 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4700 | Open in IMG/M |
| 3300022061|Ga0212023_1025782 | Not Available | 806 | Open in IMG/M |
| 3300022061|Ga0212023_1026054 | Not Available | 802 | Open in IMG/M |
| 3300022061|Ga0212023_1029476 | Not Available | 757 | Open in IMG/M |
| 3300022061|Ga0212023_1060398 | Not Available | 526 | Open in IMG/M |
| 3300022072|Ga0196889_1000829 | Not Available | 8634 | Open in IMG/M |
| 3300022072|Ga0196889_1001604 | Not Available | 6036 | Open in IMG/M |
| 3300022072|Ga0196889_1057012 | Not Available | 749 | Open in IMG/M |
| 3300022072|Ga0196889_1066933 | Not Available | 680 | Open in IMG/M |
| 3300022072|Ga0196889_1067540 | Not Available | 676 | Open in IMG/M |
| 3300022164|Ga0212022_1027852 | Not Available | 862 | Open in IMG/M |
| 3300022164|Ga0212022_1079309 | Not Available | 503 | Open in IMG/M |
| 3300022169|Ga0196903_1030206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300022169|Ga0196903_1031066 | Not Available | 631 | Open in IMG/M |
| 3300022178|Ga0196887_1017518 | Not Available | 2173 | Open in IMG/M |
| 3300022178|Ga0196887_1060672 | Not Available | 935 | Open in IMG/M |
| 3300022178|Ga0196887_1116882 | Not Available | 577 | Open in IMG/M |
| 3300022201|Ga0224503_10009207 | All Organisms → Viruses → Predicted Viral | 2812 | Open in IMG/M |
| 3300022201|Ga0224503_10015880 | All Organisms → Viruses → Predicted Viral | 2166 | Open in IMG/M |
| 3300022202|Ga0224498_10065989 | Not Available | 1028 | Open in IMG/M |
| 3300022822|Ga0222646_100095 | Not Available | 31728 | Open in IMG/M |
| 3300022822|Ga0222646_100238 | Not Available | 17213 | Open in IMG/M |
| 3300022822|Ga0222646_100939 | Not Available | 7427 | Open in IMG/M |
| 3300022822|Ga0222646_103749 | Not Available | 2816 | Open in IMG/M |
| 3300022839|Ga0222649_1016009 | Not Available | 1033 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10170893 | Not Available | 533 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10001164 | Not Available | 24952 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10004934 | Not Available | 5869 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10014042 | All Organisms → Viruses → Predicted Viral | 3189 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10041572 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1857 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10129873 | Not Available | 1070 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10010240 | All Organisms → Viruses → Predicted Viral | 2536 | Open in IMG/M |
| 3300023567|Ga0228694_104691 | Not Available | 1425 | Open in IMG/M |
| 3300023693|Ga0232112_1041922 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 511 | Open in IMG/M |
| 3300023694|Ga0228683_1038232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300023702|Ga0232119_1033986 | Not Available | 783 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10363734 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 611 | Open in IMG/M |
| 3300024183|Ga0228603_1050496 | Not Available | 636 | Open in IMG/M |
| 3300024185|Ga0228669_1110280 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 505 | Open in IMG/M |
| 3300024192|Ga0228637_1028178 | Not Available | 1145 | Open in IMG/M |
| 3300024221|Ga0228666_1039676 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300024228|Ga0228633_1000034 | Not Available | 37584 | Open in IMG/M |
| 3300024235|Ga0228665_1069133 | Not Available | 728 | Open in IMG/M |
| 3300024237|Ga0228653_1030216 | Not Available | 1270 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10161297 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| (restricted) 3300024259|Ga0233437_1185989 | Not Available | 900 | Open in IMG/M |
| 3300024281|Ga0228610_1066771 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 526 | Open in IMG/M |
| 3300024292|Ga0228630_1030257 | Not Available | 1371 | Open in IMG/M |
| 3300024294|Ga0228664_1025242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1652 | Open in IMG/M |
| 3300024294|Ga0228664_1038818 | Not Available | 1214 | Open in IMG/M |
| 3300024332|Ga0228659_1022083 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
| 3300024335|Ga0228672_1190842 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 504 | Open in IMG/M |
| 3300024346|Ga0244775_10014716 | Not Available | 7287 | Open in IMG/M |
| 3300024346|Ga0244775_10452607 | All Organisms → Viruses | 1052 | Open in IMG/M |
| 3300024346|Ga0244775_10551668 | Not Available | 938 | Open in IMG/M |
| 3300024415|Ga0228662_1021238 | Not Available | 1818 | Open in IMG/M |
| 3300024428|Ga0233396_1031318 | Not Available | 1603 | Open in IMG/M |
| 3300024508|Ga0228663_1047629 | Not Available | 814 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10554755 | Not Available | 535 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10531975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10468528 | Not Available | 602 | Open in IMG/M |
| 3300025276|Ga0208814_1000420 | Not Available | 27438 | Open in IMG/M |
| 3300025276|Ga0208814_1090878 | Not Available | 788 | Open in IMG/M |
| 3300025508|Ga0208148_1032205 | Not Available | 1401 | Open in IMG/M |
| 3300025570|Ga0208660_1019740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2005 | Open in IMG/M |
| 3300025577|Ga0209304_1001565 | Not Available | 13629 | Open in IMG/M |
| 3300025577|Ga0209304_1028699 | Not Available | 1663 | Open in IMG/M |
| 3300025594|Ga0209094_1029099 | Not Available | 1623 | Open in IMG/M |
| 3300025594|Ga0209094_1038764 | Not Available | 1313 | Open in IMG/M |
| 3300025620|Ga0209405_1001259 | Not Available | 18849 | Open in IMG/M |
| 3300025620|Ga0209405_1004274 | Not Available | 8307 | Open in IMG/M |
| 3300025621|Ga0209504_1006258 | Not Available | 6326 | Open in IMG/M |
| 3300025621|Ga0209504_1098742 | Not Available | 768 | Open in IMG/M |
| 3300025626|Ga0209716_1002227 | All Organisms → Viruses | 13022 | Open in IMG/M |
| 3300025637|Ga0209197_1180829 | Not Available | 544 | Open in IMG/M |
| 3300025640|Ga0209198_1008758 | Not Available | 5480 | Open in IMG/M |
| 3300025641|Ga0209833_1057398 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300025645|Ga0208643_1011049 | Not Available | 3448 | Open in IMG/M |
| 3300025645|Ga0208643_1037069 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300025652|Ga0208134_1126601 | Not Available | 671 | Open in IMG/M |
| 3300025695|Ga0209653_1010261 | Not Available | 5068 | Open in IMG/M |
| 3300025701|Ga0209771_1035577 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
| 3300025809|Ga0209199_1006453 | Not Available | 9864 | Open in IMG/M |
| 3300025809|Ga0209199_1011813 | Not Available | 6315 | Open in IMG/M |
| 3300025849|Ga0209603_1211489 | Not Available | 733 | Open in IMG/M |
| 3300025849|Ga0209603_1221007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300025860|Ga0209119_1006654 | Not Available | 8699 | Open in IMG/M |
| 3300025860|Ga0209119_1211745 | Not Available | 744 | Open in IMG/M |
| 3300025874|Ga0209533_1045400 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2643 | Open in IMG/M |
| 3300025874|Ga0209533_1253989 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 703 | Open in IMG/M |
| 3300025883|Ga0209456_10237449 | Not Available | 768 | Open in IMG/M |
| 3300026427|Ga0247556_1048327 | Not Available | 955 | Open in IMG/M |
| 3300026483|Ga0228620_1101269 | Not Available | 588 | Open in IMG/M |
| 3300026511|Ga0233395_1112631 | Not Available | 684 | Open in IMG/M |
| 3300027206|Ga0208023_1037162 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 823 | Open in IMG/M |
| 3300027413|Ga0208950_1004987 | All Organisms → Viruses → Predicted Viral | 4940 | Open in IMG/M |
| 3300027668|Ga0209482_1000849 | Not Available | 24189 | Open in IMG/M |
| 3300027672|Ga0209383_1004594 | All Organisms → Viruses | 7416 | Open in IMG/M |
| 3300027672|Ga0209383_1037209 | Not Available | 1919 | Open in IMG/M |
| 3300027672|Ga0209383_1039390 | Not Available | 1846 | Open in IMG/M |
| 3300027687|Ga0209710_1006719 | Not Available | 6988 | Open in IMG/M |
| 3300027704|Ga0209816_1167935 | Not Available | 762 | Open in IMG/M |
| 3300027714|Ga0209815_1000934 | Not Available | 20451 | Open in IMG/M |
| 3300027714|Ga0209815_1005860 | Not Available | 6463 | Open in IMG/M |
| 3300027714|Ga0209815_1079368 | Not Available | 1124 | Open in IMG/M |
| 3300027752|Ga0209192_10004359 | Not Available | 9023 | Open in IMG/M |
| 3300027752|Ga0209192_10072311 | Not Available | 1485 | Open in IMG/M |
| 3300027780|Ga0209502_10002828 | Not Available | 14116 | Open in IMG/M |
| 3300027820|Ga0209578_10206987 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 933 | Open in IMG/M |
| 3300027833|Ga0209092_10012986 | Not Available | 5960 | Open in IMG/M |
| 3300027833|Ga0209092_10046082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2724 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10252766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300027845|Ga0209271_10003943 | Not Available | 5589 | Open in IMG/M |
| 3300027849|Ga0209712_10001182 | Not Available | 22454 | Open in IMG/M |
| 3300027849|Ga0209712_10035150 | Not Available | 3158 | Open in IMG/M |
| 3300027883|Ga0209713_10000829 | Not Available | 17738 | Open in IMG/M |
| 3300027883|Ga0209713_10520424 | Not Available | 774 | Open in IMG/M |
| 3300028125|Ga0256368_1013405 | Not Available | 1407 | Open in IMG/M |
| 3300028125|Ga0256368_1023986 | Not Available | 1083 | Open in IMG/M |
| 3300028128|Ga0228645_1024853 | Not Available | 1314 | Open in IMG/M |
| 3300028130|Ga0228619_1021155 | All Organisms → Viruses → Predicted Viral | 2089 | Open in IMG/M |
| 3300028131|Ga0228642_1172052 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 505 | Open in IMG/M |
| 3300028134|Ga0256411_1049461 | Not Available | 1429 | Open in IMG/M |
| 3300028284|Ga0257120_1005329 | Not Available | 6364 | Open in IMG/M |
| 3300028284|Ga0257120_1019626 | All Organisms → Viruses → Predicted Viral | 2269 | Open in IMG/M |
| 3300028284|Ga0257120_1047502 | Not Available | 1125 | Open in IMG/M |
| 3300028287|Ga0257126_1070987 | Not Available | 1345 | Open in IMG/M |
| 3300028290|Ga0247572_1041556 | Not Available | 1079 | Open in IMG/M |
| 3300028396|Ga0228643_1129134 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 578 | Open in IMG/M |
| 3300028396|Ga0228643_1141165 | Not Available | 546 | Open in IMG/M |
| 3300028397|Ga0228639_1120471 | Not Available | 637 | Open in IMG/M |
| 3300028418|Ga0228615_1146707 | Not Available | 611 | Open in IMG/M |
| 3300031519|Ga0307488_10017050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5869 | Open in IMG/M |
| 3300031519|Ga0307488_10030394 | All Organisms → Viruses → Predicted Viral | 4304 | Open in IMG/M |
| 3300031519|Ga0307488_10807411 | Not Available | 518 | Open in IMG/M |
| 3300031569|Ga0307489_10189574 | Not Available | 1267 | Open in IMG/M |
| 3300031569|Ga0307489_10432000 | Not Available | 883 | Open in IMG/M |
| 3300031601|Ga0307992_1122343 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300031601|Ga0307992_1222604 | Not Available | 689 | Open in IMG/M |
| 3300031601|Ga0307992_1275186 | Not Available | 594 | Open in IMG/M |
| 3300031603|Ga0307989_1064783 | Not Available | 659 | Open in IMG/M |
| 3300031608|Ga0307999_1000184 | Not Available | 17804 | Open in IMG/M |
| 3300031645|Ga0307990_1179627 | Not Available | 852 | Open in IMG/M |
| 3300031645|Ga0307990_1226484 | Not Available | 712 | Open in IMG/M |
| 3300031659|Ga0307986_10336528 | Not Available | 622 | Open in IMG/M |
| 3300031687|Ga0308008_1021229 | All Organisms → Viruses → Predicted Viral | 1640 | Open in IMG/M |
| 3300031696|Ga0307995_1031536 | All Organisms → Viruses → Predicted Viral | 2323 | Open in IMG/M |
| 3300031696|Ga0307995_1289064 | Not Available | 548 | Open in IMG/M |
| 3300031703|Ga0308002_1101204 | Not Available | 618 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.10% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 10.94% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.11% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 9.38% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.81% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.25% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 4.43% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.65% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.39% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.86% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.86% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 2.60% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.08% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.82% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.56% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.30% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.30% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.30% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.30% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.30% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.04% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.78% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.52% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.52% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.52% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.52% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.52% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.26% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.26% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.26% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.26% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Microbialites → Marine | 0.26% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.26% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.26% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000119 | Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000127 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45m | Environmental | Open in IMG/M |
| 3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
| 3300000130 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50m | Environmental | Open in IMG/M |
| 3300000243 | Svalbard Archipelago station 2 sample NOR 18_50m | Environmental | Open in IMG/M |
| 3300000270 | Marine microbial mat from the Comau fjord, Huinay, Chile. Sample sequenced in March 2012 | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002186 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome | Environmental | Open in IMG/M |
| 3300002674 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_10m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004642 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006622 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ08 time point | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006850 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011126 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012516 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018569 | Metatranscriptome of marine microbial communities from Baltic Sea - GS678_0p8 | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020263 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX555942-ERR599125) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300022839 | Saline water microbial communities from Ace Lake, Antarctica - #337 | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300023567 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023693 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023694 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023702 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024183 | Seawater microbial communities from Monterey Bay, California, United States - 3D | Environmental | Open in IMG/M |
| 3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
| 3300024192 | Seawater microbial communities from Monterey Bay, California, United States - 47D | Environmental | Open in IMG/M |
| 3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024281 | Seawater microbial communities from Monterey Bay, California, United States - 11D | Environmental | Open in IMG/M |
| 3300024292 | Seawater microbial communities from Monterey Bay, California, United States - 37D | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024332 | Seawater microbial communities from Monterey Bay, California, United States - 73D | Environmental | Open in IMG/M |
| 3300024335 | Seawater microbial communities from Monterey Bay, California, United States - 90D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024415 | Seawater microbial communities from Monterey Bay, California, United States - 76D | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300024508 | Seawater microbial communities from Monterey Bay, California, United States - 77D | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026427 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 1R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
| 3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027883 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028130 | Seawater microbial communities from Monterey Bay, California, United States - 22D | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028284 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10 | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028396 | Seawater microbial communities from Monterey Bay, California, United States - 55D | Environmental | Open in IMG/M |
| 3300028397 | Seawater microbial communities from Monterey Bay, California, United States - 50D | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
| 3300031603 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #185 | Environmental | Open in IMG/M |
| 3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
| 3300031645 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031703 | Marine microbial communities from water near the shore, Antarctic Ocean - #34 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100201843 | 3300000101 | Marine | MRAVYCKCKNTYSIECNNNNDKECNAPEYWKQGIGRISASEEE* |
| DelMOSum2010_100263063 | 3300000101 | Marine | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEES* |
| DelMOSum2010_100294363 | 3300000101 | Marine | MRAVYCKCKNTYSIECRQNNDKDCNAPYYWKQGIGSIYNNDDEN* |
| DelMOSum2010_100451143 | 3300000101 | Marine | MKAKYCKCKNTYSIECDKYSKKRKCNADEYWKQGIGSIHKQEEE* |
| DelMOSum2010_100457154 | 3300000101 | Marine | VNLKNYYRMARAVYCKCKNTYSIDCDKDGKKCKSDEYWKQGIGSIYKETEE* |
| DelMOSum2010_100462262 | 3300000101 | Marine | MRAVYCKCKNTYSIKCDKNKNNSKCKAPDYWKQGIGSIHKESEE* |
| DelMOSum2010_100673882 | 3300000101 | Marine | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEEN* |
| DelMOSum2010_100895954 | 3300000101 | Marine | MRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGRINAIEEEN* |
| DelMOSum2010_102520641 | 3300000101 | Marine | MRAVYCKCKNTYSIECKQNQGKECNAPEYWKQGIGSINATEEN* |
| DelMOSum2010_102542742 | 3300000101 | Marine | MRAVYCKCKNTYSIECKNTTDKSCKTLEYWKQGIGRISATEEEE* |
| DelMOSum2010_102570103 | 3300000101 | Marine | MRAVYCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE* |
| DelMOSum2011_100242613 | 3300000115 | Marine | MRAVXCKCLNTYSIKCKEEPEKNCETPDYWKQGIGDINNTEE* |
| DelMOSum2011_101766702 | 3300000115 | Marine | MRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGNISNTDEE* |
| DelMOSum2011_101933282 | 3300000115 | Marine | AVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEDEN* |
| DelMOSum2011_101967012 | 3300000115 | Marine | MRAVYCKCLNTYSVECKTNPIKGCETPEYWKQGIGNISNTEEE* |
| DelMOSum2011_102305961 | 3300000115 | Marine | MKAVYCKCKNTYSIKCDKDEKKCKSSEYWKQGIGSIYKESED* |
| DelMOSpr2010_1000259811 | 3300000116 | Marine | MRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISASEEEE* |
| DelMOSpr2010_100634013 | 3300000116 | Marine | MRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGRINAIEENEE* |
| DelMOSpr2010_100709582 | 3300000116 | Marine | MRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISAKKEE* |
| DelMOSpr2010_100858432 | 3300000116 | Marine | MRAVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISASEEEE* |
| DelMOSpr2010_101148793 | 3300000116 | Marine | MRAVYCKCKNTYSIDCKNKNDKNCKTPYYWKQGIGRISASEEEE* |
| DelMOSpr2010_101250321 | 3300000116 | Marine | IIMRAVYCKCKNTYSIDCKDKNDKNCKTPYYWKQGIGRISASEEEE* |
| DelMOSpr2010_101741972 | 3300000116 | Marine | YCKCKNTYSIECKNTTDKSCKTPEYWKQGIGRISATEEEE* |
| DelMOSpr2010_102234372 | 3300000116 | Marine | MRAVYCKCKNTYSIKCDKNKKNSKCKAPDYWKQGIGSIHKESEE* |
| KGI_S1_ANT01_95mDRAFT_101254692 | 3300000119 | Marine | MSKAVYCYCKNTYSIECDKGNNKRCNAPDYWKQGIGDMSNTAEED* |
| TDF_OR_ARG04_113mDRAFT_10034473 | 3300000121 | Marine | MSRAVYCKCKNTYSIECKQNQSKDCNAPEYWKQGIGRINAIEEEN* |
| SA_S1_NOR05_45mDRAFT_100062735 | 3300000127 | Marine | MSRAVYCKCKNTYSIECKTNQGKECNVPEYWKQGIGRINAIEEEN* |
| SA_S1_NOR05_45mDRAFT_100098765 | 3300000127 | Marine | MRAVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGNISNTDEE* |
| SA_S1_NOR05_45mDRAFT_101354532 | 3300000127 | Marine | MAKAVYCKCKNTYSIDCDKDGKKCKSDEYWKQGIGSIYKETEE* |
| SA_S1_NOR08_45mDRAFT_100320921 | 3300000128 | Marine | MRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGNIS |
| SA_S1_NOR08_45mDRAFT_100355102 | 3300000128 | Marine | MSRAVYCKCKNTYSIECKTNPVKGCETPEYWKQGIGNISNTDEE* |
| SA_S1_NOR08_45mDRAFT_100810881 | 3300000128 | Marine | MARAVYCKCKNTYSIDCDKDGKKCKSDEYWKQGIGSIYKETEE* |
| SA_S2_NOR15_50mDRAFT_100990391 | 3300000130 | Marine | MKAVYCKCSNTYSIKCDKDEKKCKSAEYWKQGIGSIYKETEE* |
| SA_S2_NOR18_50mDRAFT_10213172 | 3300000243 | Marine | MSRAVYCKXKNTYSIECKTNQGKECNVPEYWKQGIGRINAIEEEN* |
| HuiMet_1004654 | 3300000270 | Marine | MRAKYCKCKNTYSIKCDKYSKRKKCNDDEYWKQGIGSIRKTTEE* |
| OpTDRAFT_100328902 | 3300000928 | Freshwater And Marine | MRAKYCKCKNTYSIKCDKNKNNSKCKAPDYWKQGIGSIHKESEE* |
| BBAY94_101076992 | 3300000949 | Macroalgal Surface | MSRAVYCKCKNTYSIECKQNQNKDCNAPEYWKQGIGRINAIEEDN* |
| JGI20152J14361_100566261 | 3300001344 | Pelagic Marine | VYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEDEN* |
| JGI20154J14316_100527753 | 3300001348 | Pelagic Marine | MRAVYCKCKNTYSIKCDKKKNNSKCKAPDYWXQGIGSIXKESEE* |
| JGI20153J14318_100201862 | 3300001351 | Pelagic Marine | MRAVYCKCKNTYSIECKTNQGKDCNAPEYWNQGIGRINAIEEEN* |
| JGI20153J14318_100296922 | 3300001351 | Pelagic Marine | MRAVYCKCKNTYSIKCDKKKNNSKCKAPDYWKQGIGSIHKESEE* |
| JGI20153J14318_100493072 | 3300001351 | Pelagic Marine | MRAVYCKCKNTYSIDXKNTTDKSCKTPEYWKQGIGRISATEEEE* |
| JGI20153J14318_101094993 | 3300001351 | Pelagic Marine | AVYCKCKNTYSIECKNTTDKSCKTPEYWKQGIGRISATEEEE* |
| M2t2BS2_103832393 | 3300002144 | Marine | MAKAVYCKCRNTYSIECDKAGKKCNADEYWKQGIGSIYKETEE* |
| M2t2BS2_1073245822 | 3300002144 | Marine | MRAVYCKCLNTYSIECKQNEVKGCDAPDYWKQGIGSIYKVDEE* |
| JGI24539J26755_100953091 | 3300002186 | Marine | MRAKYCKCKNTYSIDCDKYTKKRKCNADEYWKQGIGSIHKQ |
| Ga0005252J37289_1010781 | 3300002674 | Marine | TMRAKYCKCKNTYSIDCDKYSKKRKCNADEYWKQGIGSIHKQEEE* |
| JGI26079J46598_10254782 | 3300003216 | Marine | MSKIAKYCKCLNTYTNKDCDKRKCKAPYYWKQGIGSIYKESEDN* |
| JGI26084J50262_10037893 | 3300003427 | Marine | MRAVYCKCKNTYSIKCDKGKSKDCKAPYYWKQGIGSIYKEEDNDK* |
| JGI26084J50262_10167713 | 3300003427 | Marine | MRAKYCKCKNTYTIKECDKKNCKAPEYWKQGIGSIYKNSDENVN* |
| JGI26260J51721_10168951 | 3300003580 | Marine | IMRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGIGRISASEEEE* |
| JGI26260J51721_10176053 | 3300003580 | Marine | MRAKYCKCKNTYSIDCDKYSKKRKCNADEYWKQGIGSIHKQEEE* |
| JGI26260J51721_10404102 | 3300003580 | Marine | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGIGRISASEEEE* |
| JGI26260J51721_10717381 | 3300003580 | Marine | AVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISASEEEE* |
| JGI26083J51738_100073443 | 3300003621 | Marine | MXAVYCKCKXTYSIKCDKNNNRNKCKAPYYWKQGIGSIYKNTEE* |
| Ga0055584_1008737711 | 3300004097 | Pelagic Marine | MRAVYCKCENTYSIKFDEKKNNSKCKAPDYWKQGIGSIYKESEE* |
| Ga0055584_1012096852 | 3300004097 | Pelagic Marine | MRAKYCKCKNTYSIECDKYTKTRKCNADEYWKQGIGSIHKQEEE* |
| Ga0055584_1026518011 | 3300004097 | Pelagic Marine | MRAVYCKCKNTYSIDCKDKNDKNCKTPYYWKQGIGRISATEEEE* |
| Ga0066605_100894922 | 3300004279 | Marine | MKAVYCKCKNTYSIECKNNTDKHCETPEYWKQGIGRINATEEE* |
| Ga0066605_100949582 | 3300004279 | Marine | MRAVYCKCRNTYSIKCDKNKNNSKCKAPDYWKQGIGSIHKESEE* |
| Ga0065861_10088341 | 3300004448 | Marine | KSIVIMRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGNISNTDEE* |
| Ga0065861_10267421 | 3300004448 | Marine | RAVYCKCKNTYSIDCGKDSNKCKADEYWKQGIGSIHKEAEE* |
| Ga0065861_10491721 | 3300004448 | Marine | MRAVYCKCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKTEES* |
| Ga0065861_10926191 | 3300004448 | Marine | KSIVIMRSVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGNISNTDEE* |
| Ga0066224_10246552 | 3300004457 | Marine | MRSVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGNISNTDEE* |
| Ga0066222_10498731 | 3300004460 | Marine | VYCKCLNTYSIECKTNPIKGCETPEYWKQGIGNISNTDEE* |
| Ga0066223_12643141 | 3300004461 | Marine | MKAKYCKCTNTYSINCDKYKNKKKCNAPDYWKQGIGQTSKNEDE* |
| Ga0066612_10335753 | 3300004642 | Marine | MKAVYCKCKNTYSIDCDKGKKKCKSEEYWKQGIGSIHKETED* |
| Ga0070728_104801852 | 3300005588 | Marine Sediment | MRAVYCKCKNTYSIECKNTTDKSCKTPEYWKQGIGRISATEEEE* |
| Ga0070723_100128935 | 3300005612 | Marine Sediment | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGIGRISATEEEE* |
| Ga0076924_11945701 | 3300005747 | Marine | MRAVYCKCKNTYSIDCKDKDDKNCKTPYYWKQGIGRISATEEEE* |
| Ga0075462_100501822 | 3300006027 | Aqueous | MKAVYCKCKNTYSIKCDKNNNKCKAPYYWKQGIGSIYKNTEE* |
| Ga0075466_10134902 | 3300006029 | Aqueous | MRAVYCKCLNTYSIKCKEEPEKNCETPDYWKQGIGDINNTEE* |
| Ga0075466_10225742 | 3300006029 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEDEN* |
| Ga0075466_10623382 | 3300006029 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKKCNAPEYWKQGIGRINAIEEEN* |
| Ga0075466_10899013 | 3300006029 | Aqueous | VYCKCLNTYSIKCKEEPEKNCETPDYWKQGIGDINNTEE* |
| Ga0075466_11183363 | 3300006029 | Aqueous | CKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE* |
| Ga0075466_11896482 | 3300006029 | Aqueous | MRAVYCKCLNTYSIECKQKEVKGCETPEYWKQGIGTIYKVEEE* |
| Ga0075466_11925572 | 3300006029 | Aqueous | MKAVYCKCKNTYSIKCDKGEKKCKSDEYWKQGIGSIYKETED* |
| Ga0075441_100253151 | 3300006164 | Marine | MSRAVYCYCKNTYSIECDKGNNKRCNAPDYWKQGIGNISNTAEED* |
| Ga0075441_100347342 | 3300006164 | Marine | MSKAVYCKCKNTYSIECKNEQDCDAPDYWKQGIGRINAIEEDN* |
| Ga0075441_100470413 | 3300006164 | Marine | MSKAVYCYCKNTYSIECDKGNNKRCNAPDYWKQGIGDISNTAEED* |
| Ga0075441_100550712 | 3300006164 | Marine | MGKAVYCYCKNTYSIDCDKGNSKKCKAPDYWKQGIGDISNTADDD* |
| Ga0075441_100589115 | 3300006164 | Marine | MSKAVYCKCKNTYSIECKNEQDCDAPDYWKQGIGSIDKIDE* |
| Ga0075441_100949302 | 3300006164 | Marine | MKAVYCKCKNTYSIECDSNPNKGCSTPEYWKQGIGSIDKTEE* |
| Ga0075441_101008872 | 3300006164 | Marine | MKAVYCKCKNTYSIECDSSPNKGCSTPEYWKQGIGPINKTEE* |
| Ga0075441_102229262 | 3300006164 | Marine | MSKAVYCKCKNTYSIECKDEQDCKTPYYWKQGIGSINKIDE* |
| Ga0075443_101000222 | 3300006165 | Marine | MSRAVYCKCKNTYSIECKNNKDCDTPDYWKQGIGSIHKAEE* |
| Ga0099972_100125682 | 3300006467 | Marine | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGIGRISATEEE |
| Ga0070744_100467183 | 3300006484 | Estuarine | MRAVYCKCKNTYSIACRYNEDKDCNAPYYWKQGIGSIYNNDDEN* |
| Ga0070744_102109642 | 3300006484 | Estuarine | MRAVYCKCKNTYSIECKDNQGKDCNAPEYWKQGIGSINATEEN* |
| Ga0101442_1273343 | 3300006622 | Marine Surface Water | MRAKYCKCKNTYSIECDKYSKKRKCNADEYWKQGIGSIHKQEEE* |
| Ga0098048_10114483 | 3300006752 | Marine | MRAVYCKCTNTYSIKCDKNKNNSKCKSPDYWKQGIGSIYKESEE* |
| Ga0098048_10641082 | 3300006752 | Marine | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGIGKISATEEEE* |
| Ga0098048_11890572 | 3300006752 | Marine | MKAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE* |
| Ga0098054_11402562 | 3300006789 | Marine | MRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE* |
| Ga0075467_101202053 | 3300006803 | Aqueous | MRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISATEEEE* |
| Ga0075467_101877052 | 3300006803 | Aqueous | MRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGKINAIEEEN* |
| Ga0075467_104082293 | 3300006803 | Aqueous | YCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE* |
| Ga0075467_104237392 | 3300006803 | Aqueous | MRAVYCKCKNTYSIECKDKNDKNCKTPYYWKQGIGRISASEEEE* |
| Ga0075467_105576313 | 3300006803 | Aqueous | MRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEES* |
| Ga0070754_101948283 | 3300006810 | Aqueous | MRAVYCKCKNTYSIDCKNNTDKSCKTPEYWKQGIGRISAKKEE* |
| Ga0075491_14692931 | 3300006850 | Aqueous | MKAVYCKCKNTYSIKCDKGGKKCKSDEYWKQGIGSIYKETED* |
| Ga0070748_10634392 | 3300006920 | Aqueous | MRAVYCKCLNTYSIKCKEDPEKNCETPDYWKQGIGDINNTEE* |
| Ga0070748_11387753 | 3300006920 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEE |
| Ga0070748_11679262 | 3300006920 | Aqueous | MRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGRINAIQEDEN* |
| Ga0070748_13331152 | 3300006920 | Aqueous | MRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEEN* |
| Ga0075444_100222012 | 3300006947 | Marine | MSKAVYCKCKNTYSIECKDEQDCKTPYYWKQGIGFINKIDE* |
| Ga0075444_102193891 | 3300006947 | Marine | NLKNYYRMSRAVYCKCKNTYSIECKNNKDCDTPDYWKQGIGSIHKAEE* |
| Ga0075444_103642582 | 3300006947 | Marine | MNRRAVYCYCKNTYSRDCDKKKGCRCKAPDYWKQGIGDISNKGVK* |
| Ga0098046_10636632 | 3300006990 | Marine | KCKNTYSIDCKNTTDKSCKTPEYWKQGIGKISATEEEE* |
| Ga0075468_101563803 | 3300007229 | Aqueous | LNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE* |
| Ga0070747_11435043 | 3300007276 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEDEN* |
| Ga0070747_12505582 | 3300007276 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKKCNAQEYWKKGIGRINAIEEEN* |
| Ga0099847_10007679 | 3300007540 | Aqueous | MRAVYCKCKNTYSIECRYNDNKDCNAPYYWKQGIGNIYNNDDEN* |
| Ga0099847_10118503 | 3300007540 | Aqueous | MSRVVYCKCKNTYSIECKTNQGKKCNAPEYWKQGIGRINAIEEEN* |
| Ga0099847_10393812 | 3300007540 | Aqueous | MRAVYCKCKNTYSIECKDNNNKSCNAPEYWKQGIGRISATEEEE* |
| Ga0099847_10926653 | 3300007540 | Aqueous | MRAVYCKCKNTYSIECKNNTDKNCKTPEYWKQGIGSIHKAEE* |
| Ga0099847_11916211 | 3300007540 | Aqueous | MRAVYCKCKNTYSIECKDNNKSCNAPEYWNQGIGRISATEEEN* |
| Ga0099846_11019741 | 3300007542 | Aqueous | KMRAVYCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE* |
| Ga0102853_10688671 | 3300007543 | Estuarine | TYSIDCKNTTDKSCKTPEYWKQGIGKISATEEEE* |
| Ga0102817_11032412 | 3300007555 | Estuarine | MRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISAI |
| Ga0102866_11098012 | 3300007661 | Estuarine | MRAVYCKCKNTYSIECKNTTAKSCNAPEYWKQGIGRISAPEEEE* |
| Ga0102859_10226753 | 3300007708 | Estuarine | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWRQGIGRISATEEEE* |
| Ga0114916_10094562 | 3300008221 | Deep Ocean | MSKAVYCKCKNTYSIECKDEQDCKTPDYWKQGIGSINKIDE* |
| Ga0102887_12456012 | 3300008961 | Estuarine | MRAVYCKCKNTYSIDCKNTTDKSCKTPDYWKQGIGRISATEEEE* |
| Ga0115549_10276964 | 3300009074 | Pelagic Marine | MRAVYCKCKNTYSIECKTNQGKDCNAPEYWKQGIGRINAIQEDEN* |
| Ga0115549_10427843 | 3300009074 | Pelagic Marine | MRAVYCKCKNTYSIDCKQNQGKDCNAPEYWKQGIGRINAIEEEN* |
| Ga0115549_10490694 | 3300009074 | Pelagic Marine | MSRAVYCKCKNTYSIECKTNQGKECNVPEYWKQGIGRINAIEDEN* |
| Ga0115549_10916802 | 3300009074 | Pelagic Marine | MRAVYCKCKNTYSIECKNTTDKSCKTTEYWKQGIGRISATEEEE* |
| Ga0115549_12202351 | 3300009074 | Pelagic Marine | KCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKTEES* |
| Ga0115550_11320531 | 3300009076 | Pelagic Marine | MSRAVYCKCKNTYSIECKTNQDKECNAPEYWKQGIGRINAIEDEN* |
| Ga0115550_11545961 | 3300009076 | Pelagic Marine | YCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEEN* |
| Ga0115550_11633921 | 3300009076 | Pelagic Marine | LMRAVYCKCKNTYSIECKNTTDKSCKTTEYWKQGIGRISATEEEE* |
| Ga0115550_11712312 | 3300009076 | Pelagic Marine | MKAVYCKCKNTYSIKCDKDEKKCKSSEYWKQGIGSIYKE |
| Ga0115550_12272411 | 3300009076 | Pelagic Marine | AVYCKCKNTYSIECKTNQGKDCNAPEYWKQGIGRINAIQEDEN* |
| Ga0115550_12619252 | 3300009076 | Pelagic Marine | MRAVYCKCKNTYSIDCKNKNDKNCNTPEYWKQGIGRI |
| Ga0115550_12625081 | 3300009076 | Pelagic Marine | MSRAVYCKCKNTYSIECKTDQGKECNAPEYWKQGIGRINAIE |
| Ga0102814_104981141 | 3300009079 | Estuarine | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGVGRISATEEEE* |
| Ga0102814_107428782 | 3300009079 | Estuarine | MRAVYCKCKNTYSIECKDNNNKNCNAPEYWKQGIGRISATEEEE* |
| Ga0114995_100380923 | 3300009172 | Marine | MRAVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGRINAIEDEE* |
| Ga0114995_102099424 | 3300009172 | Marine | IMRAVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGRINAIEEDEE* |
| Ga0115548_11630651 | 3300009423 | Pelagic Marine | AKYCKCKNTYTIKGCDKKNCNAPEYWKQGIGSIYKNSDENVN* |
| Ga0114915_11361472 | 3300009428 | Deep Ocean | MSKAVYCKCKNTYSIECKNEQDCDAPDYWKQGIGSINKIDE* |
| Ga0114915_11738492 | 3300009428 | Deep Ocean | MSKAVYCKCKNTYSIECKNDKDCDVPEYWKQGIGKIRKTEES* |
| Ga0115005_103953304 | 3300009432 | Marine | MRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGNISNTEEE* |
| Ga0115005_104104793 | 3300009432 | Marine | MRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGNISNTDEQ* |
| Ga0115005_108794312 | 3300009432 | Marine | MAKAVYCKCKNTYSIECKNNKDKKCNATEYWKQGIRTINKIEE* |
| Ga0115562_13119572 | 3300009434 | Pelagic Marine | MRAVYCKCLNTYSIECKTNQVKGCETPEYWKQGIGRINAIEEDEE* |
| Ga0115546_13393472 | 3300009435 | Pelagic Marine | MRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIQEDEN* |
| Ga0115008_102802841 | 3300009436 | Marine | INSMRAVYCKCKNTYSIKCDKKKNNSKCKAPDYWEQGIGSIHKESEE* |
| Ga0115008_104444172 | 3300009436 | Marine | MRAVYCKCKNTYSIECRQSNDKDCNAPYYWKQGIGSIYNNDDEN* |
| Ga0115008_114198891 | 3300009436 | Marine | MRAVYCKCKNTYSIKCDKKKNNSKCKAPDYWEQGIGSI |
| Ga0115559_10099305 | 3300009438 | Pelagic Marine | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIENEN* |
| Ga0115561_10986661 | 3300009440 | Pelagic Marine | AVYCKCKNTYSIECKDNNKSCNAPEYWKQGIGRISATEEEE* |
| Ga0115007_102197403 | 3300009441 | Marine | MRAVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGNISNTEEE* |
| Ga0115563_10294703 | 3300009442 | Pelagic Marine | MRAVYCKCKNTYSIECNDNNNKICNAPEYWKQGIGRISATEEEE* |
| Ga0115563_12154001 | 3300009442 | Pelagic Marine | NTYSIECKNTTDKSCKTPEYWKQGIGRISATEEEE* |
| Ga0115560_12702542 | 3300009447 | Pelagic Marine | MRAVYCKCKNTYSIECRDNNNKICNAPDYWKQGIGRISAIPATPDD |
| Ga0115565_102049231 | 3300009467 | Pelagic Marine | KNTYSIECKNTTDKSCKTPEYWKQGIGRISATEEEE* |
| Ga0115571_10183723 | 3300009495 | Pelagic Marine | MRAKYCKCKNTYSIDCDKYSKKKKCNADEYWKQGIGSIHKQEEE* |
| Ga0115564_104240643 | 3300009505 | Pelagic Marine | ILMRAVYCKCKNTYSIECKNTTDKSCKTPEYWKQGIGRISATEEEE* |
| Ga0115564_106272122 | 3300009505 | Pelagic Marine | MRAVYCKCKNTYSIECKNTTDKSCKTPEYWKQGIGRIS |
| Ga0115572_100651502 | 3300009507 | Pelagic Marine | MRAVYCKCKNTYSIECKQNQGKDCNAPDYWKQGIGSINATEEN* |
| Ga0115572_104170852 | 3300009507 | Pelagic Marine | MRAVYCKCKNTYSIECKTNQGKDCNAPEYWKQGIGRINAIEDEN* |
| Ga0115004_109457842 | 3300009526 | Marine | IMRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGNISNTDEE* |
| Ga0115006_102598311 | 3300009544 | Marine | MSRAVYCKCKNTYSIECKTNAEKGCKTLDYWKQGIGKIKKSENENTKQ* |
| Ga0115006_112333682 | 3300009544 | Marine | MSGAVYCKCKNTYSIECKNNAEKGCKTLDYWKQGIGKIKKSENENTKQ* |
| Ga0115006_118157102 | 3300009544 | Marine | MRAVYCKCLNTYSIECKTNPVKGCETPEYWRQGIGNISNTDEE* |
| Ga0115102_104988922 | 3300009606 | Marine | KCKNTYSIECKQNQGKDCNAPDYWKQGIGSINATEEN* |
| Ga0115102_108728269 | 3300009606 | Marine | MRAVYCKCRNTYSIKCDKNKNNRKCKAPDYWKQGIGSIHKESEE* |
| Ga0115102_109004711 | 3300009606 | Marine | MRAVYCKCKNTYSIECRYNEDKDCNAPYYWKQGIGSIYNNDDEN* |
| Ga0115001_104678901 | 3300009785 | Marine | KSIVIMRAVYCKCLNNYSIECKTNPVKGCETPEYWKQEIGNISNTDEE* |
| Ga0098056_10339792 | 3300010150 | Marine | MRAVYCKCKNTYSIDCKNNNDKNCKTLEYWKQGIGRISASEEEE* |
| Ga0136655_10563431 | 3300010316 | Freshwater To Marine Saline Gradient | KCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE* |
| Ga0118731_1006212543 | 3300010392 | Marine | CKCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKTEES* |
| Ga0118731_1016292912 | 3300010392 | Marine | MSKAVYCRCRNTYSIECKDKDDCPYPEYWKQGIGSITKEPED* |
| Ga0118733_1024659472 | 3300010430 | Marine Sediment | MKAVYCKCKNTYSIDCKNNNDKNCKTPYYWKQGIGRISASEEEE* |
| Ga0133547_121068621 | 3300010883 | Marine | MKAVYCKCKNTYSIDCSTNPVKGCEAPEYWKQGIGSIDKTEE* |
| Ga0133547_121500813 | 3300010883 | Marine | MRAVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGNISNTNEE* |
| Ga0151654_10150301 | 3300011126 | Marine | MRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGSINATEE |
| Ga0151675_10351361 | 3300011254 | Marine | MRAVYCKCKNTYSIDCKDNDDNYCNAPYYWKQGIGRISATEEEE* |
| Ga0129325_10814571 | 3300012516 | Aqueous | VYCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE* |
| Ga0129327_104004341 | 3300013010 | Freshwater To Marine Saline Gradient | CKKMRAVYCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE* |
| Ga0164313_100979573 | 3300013101 | Marine Sediment | MRAVYCKCKNTYSIECKQNQGKDCNAPDYWKQGIGSINATEEDN* |
| Ga0164313_111878932 | 3300013101 | Marine Sediment | MRAVYCKCKNTYSIECRYNDNKDCNAPYYWKQGIGSIYNND |
| Ga0181393_10292773 | 3300017748 | Seawater | IIIMRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0181422_12443492 | 3300017762 | Seawater | MRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGKISASEEEE |
| Ga0181424_1000037912 | 3300017786 | Seawater | MRAKYCKCKNTYSIECDKYSKKRKCSADEYWKQGIGSIHKQEEE |
| Ga0181424_101245962 | 3300017786 | Seawater | MRAKYCKCKNTYSIKCDKNKNNSKCKSPDYWKQGIGSI |
| Ga0188844_1007472 | 3300018569 | Freshwater Lake | MSKAVYCYCLNTYSIECKDKECEAPEYWKQGIGNIGGKVLPEE |
| Ga0188839_10312991 | 3300019122 | Freshwater Lake | MRAVYCKCLNTYSIECKQNEVKGCDAPDYWKQGIGSIYK |
| Ga0206125_100103376 | 3300020165 | Seawater | MRAVYCKCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKTEES |
| Ga0206125_100719423 | 3300020165 | Seawater | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGIGRISATEEEE |
| Ga0206125_102396911 | 3300020165 | Seawater | LMRAVYCKCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKTEES |
| Ga0206125_102452321 | 3300020165 | Seawater | LMRAVYCKCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKTE |
| Ga0206125_103093932 | 3300020165 | Seawater | MRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISASEEEE |
| Ga0206128_12584672 | 3300020166 | Seawater | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEEN |
| Ga0206128_12595961 | 3300020166 | Seawater | KTIIIMRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISASEEEE |
| Ga0206127_10156028 | 3300020169 | Seawater | MRAVYCKCKNTYSIECKQNQGKDCNAPDYWKQGIGSINATEEN |
| Ga0206127_11261563 | 3300020169 | Seawater | MRAVYCKCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKTE |
| Ga0206127_12321892 | 3300020169 | Seawater | MRAVYCKCKNTYSIDCKDKDDKNCKTPYYWKQGIGRISATEEEE |
| Ga0206131_100020184 | 3300020185 | Seawater | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEDEN |
| Ga0206131_100278182 | 3300020185 | Seawater | MRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0206130_100006081 | 3300020187 | Seawater | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRI |
| Ga0206130_101240074 | 3300020187 | Seawater | IIIMSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEEN |
| Ga0206130_103223183 | 3300020187 | Seawater | KCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKTEES |
| Ga0211679_10402162 | 3300020263 | Marine | MRSVYCKCKNTYSIECENNAEKGCETPDYWKQGIGKTRKSENEKQNY |
| Ga0211504_10123002 | 3300020347 | Marine | MRAVYCKCKNTYSIDCKSKDDKNCKTPEYWKQGIGRISATEEEE |
| Ga0211505_10811252 | 3300020352 | Marine | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGIGKISATEEEE |
| Ga0211680_100244251 | 3300020389 | Marine | MSRAVYCYCKNTYSIECDKGNNKRCNAPDYWKQGIGNISNTAEED |
| Ga0211680_100472593 | 3300020389 | Marine | MSKAVYCKCKNTYSIECKDEQDCKTPDYWKQGIGSINKIDE |
| Ga0206126_100450125 | 3300020595 | Seawater | ILMRAVYCKCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKTEES |
| Ga0206126_100584861 | 3300020595 | Seawater | MRAVYCKCKNTYSIECKTETKKDCKTPEYWKQGIGKIRK |
| Ga0206677_100103956 | 3300021085 | Seawater | MKAVYCKCKNTYSIDCDKGKKKCKSEEYWKQGIGSIYKETED |
| Ga0206682_100574473 | 3300021185 | Seawater | MRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGRINAIEEEN |
| Ga0206682_102751933 | 3300021185 | Seawater | MRAVYCKCKNTYSIECKTNQGKDCNAPEYWKQGIGRINAIQEDEN |
| Ga0206692_16388801 | 3300021350 | Seawater | MRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGRIN |
| Ga0213865_103458431 | 3300021373 | Seawater | MRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISAKKEE |
| Ga0213869_1000046948 | 3300021375 | Seawater | MKAVYCKCKNTYSIKCDKGGKKCKSDEYWKQGIGSIYKETED |
| Ga0213868_100850893 | 3300021389 | Seawater | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEDN |
| Ga0213868_103799831 | 3300021389 | Seawater | KNTYSIDCKDKDDKNCKTPYYWKQGIGRISATEEEE |
| Ga0222717_100042524 | 3300021957 | Estuarine Water | MKAVYCKCKNTYSIECKNNTDKNCETPEYWKQGIGRINATEEE |
| Ga0222717_100288034 | 3300021957 | Estuarine Water | MRAVYCKCKNTYSIECRYNDNKDCNAPYYWKQGIGNIYNNDDEN |
| Ga0222717_105659451 | 3300021957 | Estuarine Water | KTIIIMRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0222716_100564833 | 3300021959 | Estuarine Water | MRAKYCKCKNTYSIECDKYTKKRKCNADEYWKQGIGSIHKQEEE |
| Ga0222716_106392172 | 3300021959 | Estuarine Water | MRAVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0222716_107318472 | 3300021959 | Estuarine Water | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGIGRISASEEEE |
| Ga0196883_10050413 | 3300022050 | Aqueous | MRAVYCKCKNTYSIDCKNNTDKSCKTPEYWKQGIGRISAKKEE |
| Ga0212030_10070522 | 3300022053 | Aqueous | MRAVYCKCKNTYSIECKNNTDKNCKTPEYWKQGIGSIHKAEE |
| Ga0212030_10097432 | 3300022053 | Aqueous | MRAVYCKCKNTYSIECKDNNNKSCNAPEYWKQGIGRISATEEEE |
| Ga0212030_10354132 | 3300022053 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKKCNAPEYWKQGIGRINAIEEEN |
| Ga0212030_10552702 | 3300022053 | Aqueous | MRAVYCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE |
| Ga0212030_10646471 | 3300022053 | Aqueous | MRAVYCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYK |
| Ga0212023_10001984 | 3300022061 | Aqueous | MKAVYCKCKNTYSIKCDKDEKKCKSSEYWKQGIGSIYKESED |
| Ga0212023_10257821 | 3300022061 | Aqueous | GSCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE |
| Ga0212023_10260541 | 3300022061 | Aqueous | WNKMRAVYCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE |
| Ga0212023_10294762 | 3300022061 | Aqueous | MRAVYCKCKNTYSIDCKNKNDKNCKTPYYWKQGIGRISASEEEE |
| Ga0212023_10603982 | 3300022061 | Aqueous | MRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGRINAIQEDEN |
| Ga0212021_10049463 | 3300022068 | Aqueous | MSKIAKYCKCLNTYTNKDCDKRKCKAPYYWKQGIGSIYKESEDN |
| Ga0196889_10008299 | 3300022072 | Aqueous | MRAVYCKCLNTYSIKCKEEPEKNCETPDYWKQGIGDINNTEE |
| Ga0196889_10016046 | 3300022072 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRIN |
| Ga0196889_10570122 | 3300022072 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEES |
| Ga0196889_10669332 | 3300022072 | Aqueous | MRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEES |
| Ga0196889_10675402 | 3300022072 | Aqueous | MRAVYCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVE |
| Ga0212022_10278522 | 3300022164 | Aqueous | MRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGNISNTDEE |
| Ga0212022_10793092 | 3300022164 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKECNVPEYWKQGIGRINAIEEEN |
| Ga0196903_10302061 | 3300022169 | Aqueous | MKAKYCKCTNTYSINCDKYKNKKKCNAPDYWKQGIGQTSKNEDE |
| Ga0196903_10310661 | 3300022169 | Aqueous | AVYCKCKNTYSIECRYNDNKDCNAPYYWKQGIGNIYNNDDEN |
| Ga0196887_10175186 | 3300022178 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKECNVPEYWKQGIGRINAIEKEN |
| Ga0196887_10606723 | 3300022178 | Aqueous | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEEE |
| Ga0196887_11168822 | 3300022178 | Aqueous | MRAVYCKCLNTYSIKCIEDPEKNCETPEYWKQGIGDINNTEE |
| Ga0224503_100092073 | 3300022201 | Sediment | MRAKYCKCKNTYSIDCDKYSKKRKCNADEYWKQGIGSIHKQEEE |
| Ga0224503_100158803 | 3300022201 | Sediment | MRAVYCKCKNTYSIDCKNKNDKNCKTLEYWKQGIGRISASEEEE |
| Ga0224498_100659891 | 3300022202 | Sediment | RNTYSIKCDKNKNNSKCKSPDYWKQGIGSIHKESEE |
| Ga0222646_10009549 | 3300022822 | Saline Water | MSRAVYCYCKNTYSIECKDSQMKGCKAPDYWKQGIGSIHKTEEE |
| Ga0222646_10023820 | 3300022822 | Saline Water | MSKAVYCYCKNTYSIECDKGNNKRCNAPDYWKQGVGDISNTAEED |
| Ga0222646_1009397 | 3300022822 | Saline Water | MARAVYCYCKNTYSIECDKKKNKKCNAPDYWKQGIGDISNTGEDD |
| Ga0222646_1037493 | 3300022822 | Saline Water | MARAVYCKCKNIYSIECKDDQKCETSDYWKQGIGNIYKTDDE |
| Ga0222649_10160092 | 3300022839 | Saline Water | MSKAVYCKCKNTYSIECKDEQDCKTPDYWKQGIGNINAVDEDN |
| (restricted) Ga0233404_101708932 | 3300022913 | Seawater | MRAVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISATEEEE |
| (restricted) Ga0233426_100011649 | 3300022920 | Seawater | MRAVYCKCKNTYSIECKQNQGKDCNAPDYWKQGIGRINAIEEEN |
| (restricted) Ga0233412_100049346 | 3300023210 | Seawater | MRAVYCKCKNTYSIECRQNNDKDCNAPYYWKQGIGSIYNNDDEN |
| (restricted) Ga0233412_100140426 | 3300023210 | Seawater | MKAVYCKCKNTYSIDCDKGKKKCKSEEYWKQGIGSIHKETED |
| (restricted) Ga0233412_100415721 | 3300023210 | Seawater | MKAVYCKCKNTYSIECKNNTDKHCETPEYWKQGIGRINATEEE |
| (restricted) Ga0233412_101298731 | 3300023210 | Seawater | KTIIIMRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGRINATEEN |
| (restricted) Ga0233410_100102401 | 3300023276 | Seawater | MRAKYCKCKNTYSIKCDKNKNNSKCKAPDYWKQGIGSIHKESE |
| Ga0228694_1046913 | 3300023567 | Seawater | MRAVYCKCKNTYSIDCNNTTDKSCKTPEYWKQGIGRISATEEEE |
| Ga0232112_10419222 | 3300023693 | Seawater | AVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0228683_10382321 | 3300023694 | Seawater | KCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISATEEEE |
| Ga0232119_10339862 | 3300023702 | Seawater | CKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISASEEEE |
| (restricted) Ga0255040_103637342 | 3300024059 | Seawater | MRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGSINATEEN |
| Ga0228603_10504962 | 3300024183 | Seawater | VYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0228669_11102801 | 3300024185 | Seawater | MRAVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISAS |
| Ga0228637_10281781 | 3300024192 | Seawater | MRAVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRIS |
| Ga0228666_10396762 | 3300024221 | Seawater | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGVGRISATEEEE |
| Ga0228633_100003450 | 3300024228 | Seawater | MKAKYCKCKNTYSIECDKYSKKRKCNADEYWKQGIGSIHKQEEE |
| Ga0228665_10691332 | 3300024235 | Seawater | MKAVYCKCKNTYSIECKNNTDKHCETPEYWKQGIGRINADEEE |
| Ga0228653_10302163 | 3300024237 | Seawater | MRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISATEEEE |
| (restricted) Ga0233438_101612973 | 3300024255 | Seawater | MKAVYCKCRNTYSIKCSKDKKNKDCKAPYYWEQGIGSIYKEEKED |
| (restricted) Ga0233437_11859893 | 3300024259 | Seawater | RNTYSIKCDKNKNNSKCKAPDYWKQGIGSIHKESEE |
| Ga0228610_10667711 | 3300024281 | Seawater | IIMIAVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0228630_10302571 | 3300024292 | Seawater | KNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0228664_10252423 | 3300024294 | Seawater | MRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGVGRISATEEEE |
| Ga0228664_10388184 | 3300024294 | Seawater | MRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEN |
| Ga0228659_10220831 | 3300024332 | Seawater | KCKNTYSIECDKYSKKRKCNADEYWKQGIGSIHKQEEE |
| Ga0228672_11908421 | 3300024335 | Seawater | RAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0244775_1001471611 | 3300024346 | Estuarine | MRAVYCKCKNTYSIECKDNQGKDCNAPEYWKQGIGSINATEEN |
| Ga0244775_104526071 | 3300024346 | Estuarine | IMRAVYCKCKNTYSIDCKNTTDKSCKTPEYWKQGVGRISATDEEE |
| Ga0244775_105516683 | 3300024346 | Estuarine | MRAVYCKCKNTYSIACRYNEDKDCNAPYYWKQGIGSIYNNDDEN |
| Ga0228662_10212381 | 3300024415 | Seawater | NTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0233396_10313185 | 3300024428 | Seawater | IMRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0228663_10476293 | 3300024508 | Seawater | KNTYSIDCDKYSKKRKCNADEYWKQGIGSIHKQEEE |
| (restricted) Ga0255049_105547552 | 3300024517 | Seawater | MRAVYCKCKNTYSIECKTNQGKDCNAPDYWKQGIGRINAIQ |
| (restricted) Ga0255048_105319751 | 3300024518 | Seawater | CKNTYSIDCKNTTDKSCKTPEYWKQGIGRISATEEEE |
| (restricted) Ga0255046_104685281 | 3300024519 | Seawater | IMRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGSINATEEN |
| Ga0208814_100042039 | 3300025276 | Deep Ocean | MRAVYCKCKNTYSIQCNNNTDKNCKTPEYWKQGIGSIHKAEE |
| Ga0208814_10908782 | 3300025276 | Deep Ocean | MSKAVYCKCKNTYSIECKNEQDCDAPDYWKQGIGRINAIEEDN |
| Ga0208148_10322053 | 3300025508 | Aqueous | VYCKCLNTYSIECKQNEVKGCETPEYWKQGIGTIYKVEEE |
| Ga0208660_10197402 | 3300025570 | Aqueous | MRAVYCKCLNTYSIECKQKEVKGCETPEYWKQGIGTIYKVEEE |
| Ga0209304_100156517 | 3300025577 | Pelagic Marine | MRAVYCKCKNTYSIECKNTTDKSCKTTEYWKQGIGRISATEEEE |
| Ga0209304_10286992 | 3300025577 | Pelagic Marine | MRAVYCKCKNTYSIECKNTTDKSCKTPEYWKQGIGRISATEEEE |
| Ga0209094_10290993 | 3300025594 | Pelagic Marine | MRAVYCKCKNTYSIDCKQNQGKDCNAPEYWKQGIGRINAIEEEN |
| Ga0209094_10387643 | 3300025594 | Pelagic Marine | MSRAVYCKCKNTYSIECKTNQGKECNVPEYWKQGIGRINAIEDEN |
| Ga0209405_100125911 | 3300025620 | Pelagic Marine | MARAVYCKCKNTYSIDCDKDGKKCKSDEYWKQGIGSIYKETEE |
| Ga0209405_10042742 | 3300025620 | Pelagic Marine | MRAVYCKCLNTYSIECKTNQVKGCETPEYWKQGIGRINAIEEDEE |
| Ga0209504_10062582 | 3300025621 | Pelagic Marine | MRAVYCKCKNTYSIKCDKNKSNSKCKAPDYWKQGIGSIYKESEE |
| Ga0209504_10987421 | 3300025621 | Pelagic Marine | MRAVYCKCKNTYSIECKTETKKDCKTPEYWKQGIGKIRKT |
| Ga0209716_100222711 | 3300025626 | Pelagic Marine | MRAKYCKCKNTYSIDCDKYSKKKKCNADEYWKQGIGSIHKQEEE |
| Ga0209197_11808291 | 3300025637 | Pelagic Marine | MRAVYCKCKNTYSIECKDNNKSCNAPEYWKQGIGRISAT |
| Ga0209198_10087588 | 3300025640 | Pelagic Marine | MRAVYCKCKNTYSIECNDNNNKICNAPEYWKQGIGRISATEEEE |
| Ga0209833_10573982 | 3300025641 | Pelagic Marine | MSRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIENEN |
| Ga0208643_10110493 | 3300025645 | Aqueous | MRAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGKINAIEEEN |
| Ga0208643_10370692 | 3300025645 | Aqueous | MRAVYCKCLNTYSIKCKEDPEKNCETPDYWKQGIGDINNTEE |
| Ga0208134_11266011 | 3300025652 | Aqueous | NTYSIECKTNQGKECNAPEYWKQGIGRINAIEDEN |
| Ga0209653_10102616 | 3300025695 | Marine | MRAKYCKCKNTYTIKECDKKNCKAPEYWKQGIGSIYKNSDENVN |
| Ga0209771_10355772 | 3300025701 | Marine | MKAVYCKCRNTYSIKCSKDKKNKNCKVPYYWEQGIGSIYKEDTEDN |
| Ga0209199_10064531 | 3300025809 | Pelagic Marine | MRAVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGNISNTEEE |
| Ga0209199_10118132 | 3300025809 | Pelagic Marine | MRAVYCKCKNTYSIDCKDKNDKNCKTPYYWKQGIGRISATEEEE |
| Ga0209603_12114893 | 3300025849 | Pelagic Marine | MRAVYCKCKNTYSIECRQSNDKDCNAPYYWKQGIGSIYNNDDEN |
| Ga0209603_12210072 | 3300025849 | Pelagic Marine | MRAKYCKCLNTYTIKGCDDKRCKAPYYWKQGIGSIYGGENTDVVN |
| Ga0209119_10066548 | 3300025860 | Pelagic Marine | MRAVYCKCKNTYSIECKTNQGKDCNAPEYWNQGIGRINAIEEEN |
| Ga0209119_12117451 | 3300025860 | Pelagic Marine | RAVYCKCKNTYSIECKTNQGKECNAPEYWKQGIGRINAIEDEN |
| Ga0209533_10454004 | 3300025874 | Pelagic Marine | MRAVYCKCKNTYSIECRQSNDKDCNAPYYWKQGIGSI |
| Ga0209533_12539891 | 3300025874 | Pelagic Marine | MSRAVYCKCKNTYSIECKTDQGKECNAPEYWKQGIGRINAIEEEN |
| Ga0209456_102374491 | 3300025883 | Pelagic Marine | MRAVYCKCKNTYSIECKNTTDKSCKTPEYWKQGIGRISATE |
| Ga0247556_10483272 | 3300026427 | Seawater | MRAVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIG |
| Ga0228620_11012692 | 3300026483 | Seawater | MRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISATEEEE |
| Ga0233395_11126312 | 3300026511 | Seawater | KNTYSIDCKNKNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0208023_10371622 | 3300027206 | Estuarine | MRAVYCKCKNTYSIDCKNTTDKSCKTPEYWRQGIGRISATEEEE |
| Ga0208950_10049876 | 3300027413 | Marine | MRAVYCKCRNTYSIKCDKNKNNSKCKSPDYWKQGIGSIHKESEE |
| Ga0209482_10008494 | 3300027668 | Marine | MSRAVYCKCKNTYSIECKNNKDCDTPDYWKQGIGSIHKAEE |
| Ga0209383_10045943 | 3300027672 | Marine | MGKAVYCYCKNTYSIDCDKGNSKKCKAPDYWKQGIGDISNTADDD |
| Ga0209383_10372093 | 3300027672 | Marine | MSKAVYCKCKNTYSIECKDEQDCKTPYYWKQGIGSINKIDE |
| Ga0209383_10393903 | 3300027672 | Marine | MSKAVYCKCKNTYSIECKNEQDCDAPDYWKQGIGSIDKIDE |
| Ga0209710_100671911 | 3300027687 | Marine | MRAVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGNISNTDEE |
| Ga0209816_11679351 | 3300027704 | Marine | TNLKNYYRMSRAVYCKCKNTYSIECKNNKDCDTPDYWKQGIGSIHKAEE |
| Ga0209815_100093425 | 3300027714 | Marine | MSKAVYCYCKNTYSIECDKGNNKRCNAPDYWKQGIGDISNTAEED |
| Ga0209815_10058603 | 3300027714 | Marine | MKAVYCKCKNTYSIECDSNPNKGCSTPEYWKQGIGSIDKTEE |
| Ga0209815_10793682 | 3300027714 | Marine | MKAVYCKCKNTYSIECDSSPNKGCSTPEYWKQGIGPINKTEE |
| Ga0209192_100043595 | 3300027752 | Marine | MRAVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGRINAIEDEE |
| Ga0209192_100723114 | 3300027752 | Marine | MRAVYCKCLNTYSIECKTNPIKGCETPEYWKQGIGRINAIEEDEE |
| Ga0209502_1000282823 | 3300027780 | Marine | MRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGNISNTEEE |
| Ga0209578_102069873 | 3300027820 | Marine Sediment | VYCKCKNTYSIECKNTTDKSCKTPEYWKQGIGRISATEEEE |
| Ga0209092_100129863 | 3300027833 | Marine | MRAVYCKCKNTYSIKCDKKKNNSKCKAPDYWEQGIGSIHKESEE |
| Ga0209092_100460823 | 3300027833 | Marine | MRAKYCKCKNTYSIDCDKYTKKRKCNADEYWKQGIGSIHKQEEE |
| (restricted) Ga0255041_102527662 | 3300027837 | Seawater | KCKNTYSIDCKNTTDKSCKTPEYWKQGIGRISATEEEE |
| Ga0209271_100039436 | 3300027845 | Marine Sediment | MRAVYCKCKNTYSIECKNTTDKSCKTLEYWKQGIGRISATEEEE |
| Ga0209712_100011824 | 3300027849 | Marine | MRAVYCKCLNTYSIECKTNPVKGCETPEYWKQGIGNISNTDEQ |
| Ga0209712_100351503 | 3300027849 | Marine | MRAVYCKCKNTYSIECNNNNDKECNAPEYWKQGIGRISASEEE |
| Ga0209713_1000082925 | 3300027883 | Marine | MAKAVYCKCKNTYSIDCDKDGKKCKSDEYWKQGIGSIYKETEE |
| Ga0209713_105204242 | 3300027883 | Marine | SRAVYCKCKNTYSIECKTNAEKGCKTLDYWKQGIGKIKKSENENTKQ |
| Ga0256368_10134052 | 3300028125 | Sea-Ice Brine | MRAVYCKCLNTYSIECKEGQKKGCETPEYWKQGIGSIYKSSEED |
| Ga0256368_10239862 | 3300028125 | Sea-Ice Brine | MRAVYCKCTNTYSIKCAEDNKKKDCNAPDYWKQGIGSIYKKEEE |
| Ga0228645_10248531 | 3300028128 | Seawater | MRAKYCKCKNTYSIDCDKYSKKRKCNADEYWKQGIGSIH |
| Ga0228619_10211554 | 3300028130 | Seawater | IIMRAVYCKCKNTYSIDCKNKNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0228642_11720522 | 3300028131 | Seawater | MRAVYCKCKNTYSIDCKNNNDKSCKTPEYWKQGIGRISATEEEE |
| Ga0256411_10494615 | 3300028134 | Seawater | CKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0257120_10053296 | 3300028284 | Marine | MRAVYCKCKNTYSIECKTNQGKDCNAPEYWKQGIGRINAIEEEN |
| Ga0257120_10196263 | 3300028284 | Marine | MRAVYCKCKNTYSIECKQNQGKDCNAPDYWKQGIGRINAIEDEN |
| Ga0257120_10475024 | 3300028284 | Marine | NTYSIECKQNQGKDCNAPDYWKQGIGRINAIEEEN |
| Ga0257126_10709872 | 3300028287 | Marine | MRAVYCKCKNTYSIECKQNQGKDCNAPEYWKQGIGRINAIQEDGN |
| Ga0247572_10415561 | 3300028290 | Seawater | TMRAKYCKCKNTYSIDCDKYLKKRKCNADEYWKQGIGSIHKQEEE |
| Ga0228643_11291342 | 3300028396 | Seawater | MRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISSTEEEE |
| Ga0228643_11411651 | 3300028396 | Seawater | KNTYSIDCKNTTDKSCKTPEYWKQGIGKISATEEEE |
| Ga0228639_11204713 | 3300028397 | Seawater | TIIIMRAVYCKCKNTYSIDCKNKDDKNCKTPYYWKQGIGRISATEEEE |
| Ga0228615_11467071 | 3300028418 | Seawater | IIMRAVYCKCKNTYSIDCKNNNDKNCKTPEYWKQGIGRISASEEEE |
| Ga0307488_100170501 | 3300031519 | Sackhole Brine | MGKAVYCYCKNTYSIDCDKGNTKKCKAPDYWKQGIG |
| Ga0307488_100303945 | 3300031519 | Sackhole Brine | MARAVYCKCKNTYSIDCGKDSNKCKADEYWKQGIGSIHKETEE |
| Ga0307488_108074112 | 3300031519 | Sackhole Brine | MRAVYCKCLNTYSIECKEGQRKGCETPEYWKQGIGSIYKSSEED |
| Ga0307489_101895741 | 3300031569 | Sackhole Brine | MRAVYCKCTNTYSIKCAEDNKKKDCNAPDYWKQGIGSIYKKE |
| Ga0307489_104320002 | 3300031569 | Sackhole Brine | MGKAVYCYCKNTYSIDCDKGNTKKCKAPDYWKQGIGDISNTAEED |
| Ga0307992_11223433 | 3300031601 | Marine | MSRAVYCKCKNTYSIECKDEQDCKTPDYWKQGIGNINSTEEE |
| Ga0307992_12226042 | 3300031601 | Marine | IIIMSKAVYCKCKNTYSIECKDEQDCETPEYWKQGIGSINKIDE |
| Ga0307992_12751861 | 3300031601 | Marine | MSRAVYCKCLNTYSIECKNNPEKGCETPEYWKQGIGNISK |
| Ga0307989_10647832 | 3300031603 | Marine | MSRAVYCKCLNTYSIECKNNPEKGCETPDYWKQGIGRTTADE |
| Ga0307999_10001847 | 3300031608 | Marine | MSRAVYCYCKNTYSIECDKGKNKRCNAPNYWKQGIGNISNTAEED |
| Ga0307990_11796272 | 3300031645 | Marine | MSKAVYCKCKNTYSIECKDEQDCETPEYWKQGIGSINKIDE |
| Ga0307990_12264843 | 3300031645 | Marine | CKCKNTYSIECKNEQDCDAPDYWKQGIGNINAVEEDN |
| Ga0307986_103365282 | 3300031659 | Marine | MAKAVYCKCLNTYSVECKENPKKGCETPDYWKQGIGSINKIEE |
| Ga0308008_10212291 | 3300031687 | Marine | MSKAVYCKCKNTYSIECKNEQDCKTPDYWKQGIGNINSTEEE |
| Ga0307995_10315361 | 3300031696 | Marine | MSRAVYCKCKNTYSIECKDEQDCKTPDYWKQGIGSINKIDE |
| Ga0307995_12890641 | 3300031696 | Marine | VYCKCKNTYSIECKNNQDCDAPDYWKQGIGNINAVDEDN |
| Ga0308002_11012042 | 3300031703 | Marine | YCKCKNTYSIECKDEQDCKTPDYWKQGIGSINKIDE |
| ⦗Top⦘ |