| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300018569 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129055 | Gp0214172 | Ga0188844 |
| Sample Name | Metatranscriptome of marine microbial communities from Baltic Sea - GS678_0p8 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 22901701 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1 |
| All Organisms → Viruses → Predicted Viral | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 58.581234 | Long. (o) | 18.232801 | Alt. (m) | N/A | Depth (m) | 74 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006002 | Metagenome / Metatranscriptome | 384 | Y |
| F090050 | Metagenome / Metatranscriptome | 108 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0188844_100747 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2445 | Open in IMG/M |
| Ga0188844_101270 | All Organisms → Viruses → Predicted Viral | 1862 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0188844_100747 | Ga0188844_1007472 | F006002 | MSKAVYCYCLNTYSIECKDKECEAPEYWKQGIGNIGGKVLPEE |
| Ga0188844_101270 | Ga0188844_1012702 | F090050 | MIRSSKESIETVVTNIENSIDYYINQHTADLNGASRIRNDASIVRGLVEYRSALLDLLEEETPRKKRGNPNFGKDNPYFTKKEGNE |
| ⦗Top⦘ |