| Basic Information | |
|---|---|
| Family ID | F004874 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 420 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFG |
| Number of Associated Samples | 299 |
| Number of Associated Scaffolds | 420 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.17 % |
| % of genes near scaffold ends (potentially truncated) | 9.29 % |
| % of genes from short scaffolds (< 2000 bps) | 74.76 % |
| Associated GOLD sequencing projects | 281 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.381 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.191 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.048 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.524 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.94% β-sheet: 0.00% Coil/Unstructured: 64.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 420 Family Scaffolds |
|---|---|---|
| PF04075 | F420H2_quin_red | 40.71 |
| PF02803 | Thiolase_C | 14.29 |
| PF01037 | AsnC_trans_reg | 8.57 |
| PF00230 | MIP | 4.76 |
| PF00266 | Aminotran_5 | 2.38 |
| PF02775 | TPP_enzyme_C | 1.19 |
| PF02151 | UVR | 0.95 |
| PF02771 | Acyl-CoA_dh_N | 0.48 |
| PF00027 | cNMP_binding | 0.48 |
| PF00072 | Response_reg | 0.48 |
| PF02770 | Acyl-CoA_dh_M | 0.24 |
| PF02514 | CobN-Mg_chel | 0.24 |
| PF02467 | Whib | 0.24 |
| PF01568 | Molydop_binding | 0.24 |
| PF13913 | zf-C2HC_2 | 0.24 |
| PF06559 | DCD | 0.24 |
| PF02595 | Gly_kinase | 0.24 |
| PF09660 | DUF2397 | 0.24 |
| PF00248 | Aldo_ket_red | 0.24 |
| PF02566 | OsmC | 0.24 |
| PF02885 | Glycos_trans_3N | 0.24 |
| PF13580 | SIS_2 | 0.24 |
| PF02965 | Met_synt_B12 | 0.24 |
| PF00108 | Thiolase_N | 0.24 |
| PF00196 | GerE | 0.24 |
| COG ID | Name | Functional Category | % Frequency in 420 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 14.52 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 4.76 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.71 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.24 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.24 |
| COG1429 | Cobalamin biosynthesis protein CobN, Mg-chelatase | Coenzyme transport and metabolism [H] | 0.24 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.24 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.24 |
| COG1929 | Glycerate kinase | Carbohydrate transport and metabolism [G] | 0.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.38 % |
| Unclassified | root | N/A | 7.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090008|P3_DRAFT_NODE_282566_len_957_cov_9_531871 | Not Available | 1007 | Open in IMG/M |
| 2124908032|Perma_A_C_ConsensusfromContig201076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
| 2124908043|A2_c1_ConsensusfromContig71282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig16031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
| 2199352025|deepsgr__Contig_111825 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101621290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300000550|F24TB_10671984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
| 3300000559|F14TC_102556899 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300000891|JGI10214J12806_10908155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300000956|JGI10216J12902_100033220 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300000956|JGI10216J12902_100171249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1002 | Open in IMG/M |
| 3300000956|JGI10216J12902_100768242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300000956|JGI10216J12902_112690706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 907 | Open in IMG/M |
| 3300000956|JGI10216J12902_116758473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
| 3300001205|C688J13580_1001987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1745 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107413915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1109 | Open in IMG/M |
| 3300001538|A10PFW1_10288994 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300001686|C688J18823_10341765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 976 | Open in IMG/M |
| 3300001837|RCM39_1016261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300001851|RCM31_10254362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| 3300002120|C687J26616_10000765 | All Organisms → cellular organisms → Bacteria | 13162 | Open in IMG/M |
| 3300002149|C687J26657_10071629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300005340|Ga0070689_101187847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300005445|Ga0070708_101115296 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005526|Ga0073909_10004425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4145 | Open in IMG/M |
| 3300005526|Ga0073909_10301165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300005529|Ga0070741_10002470 | All Organisms → cellular organisms → Bacteria | 49463 | Open in IMG/M |
| 3300005529|Ga0070741_10021071 | All Organisms → cellular organisms → Bacteria | 10182 | Open in IMG/M |
| 3300005529|Ga0070741_10049226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5163 | Open in IMG/M |
| 3300005540|Ga0066697_10282574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 979 | Open in IMG/M |
| 3300005543|Ga0070672_101540899 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005548|Ga0070665_100327148 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300005552|Ga0066701_10078413 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300005553|Ga0066695_10011435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4670 | Open in IMG/M |
| 3300005553|Ga0066695_10114541 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300005564|Ga0070664_100714290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300005564|Ga0070664_102352461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300005577|Ga0068857_102043971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300005578|Ga0068854_100399136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1137 | Open in IMG/M |
| 3300005587|Ga0066654_10104742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1373 | Open in IMG/M |
| 3300005598|Ga0066706_11330818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300005614|Ga0068856_101581321 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005617|Ga0068859_103029507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300005718|Ga0068866_10021481 | All Organisms → cellular organisms → Bacteria | 2974 | Open in IMG/M |
| 3300005718|Ga0068866_10032131 | All Organisms → cellular organisms → Bacteria | 2535 | Open in IMG/M |
| 3300005764|Ga0066903_100206062 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
| 3300005764|Ga0066903_102008966 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300005764|Ga0066903_102300941 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300005764|Ga0066903_102500716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300005764|Ga0066903_103404060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300005764|Ga0066903_104619935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
| 3300005834|Ga0068851_10482427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
| 3300005836|Ga0074470_10170009 | All Organisms → cellular organisms → Bacteria | 2775 | Open in IMG/M |
| 3300005836|Ga0074470_10955394 | All Organisms → cellular organisms → Bacteria | 21207 | Open in IMG/M |
| 3300005840|Ga0068870_10323918 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005841|Ga0068863_100673370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1027 | Open in IMG/M |
| 3300005843|Ga0068860_102190320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300005844|Ga0068862_102402063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300005844|Ga0068862_102674576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300005874|Ga0075288_1002005 | All Organisms → cellular organisms → Bacteria | 2599 | Open in IMG/M |
| 3300005884|Ga0075291_1010440 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300005886|Ga0075286_1008010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
| 3300005985|Ga0081539_10018303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4868 | Open in IMG/M |
| 3300005985|Ga0081539_10065014 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300006031|Ga0066651_10324637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300006031|Ga0066651_10329010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300006046|Ga0066652_100047403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3213 | Open in IMG/M |
| 3300006046|Ga0066652_100158189 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
| 3300006046|Ga0066652_100671413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
| 3300006046|Ga0066652_100768973 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300006047|Ga0075024_100078077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1422 | Open in IMG/M |
| 3300006173|Ga0070716_100736510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300006173|Ga0070716_101760152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300006175|Ga0070712_100764918 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300006224|Ga0079037_100026953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4179 | Open in IMG/M |
| 3300006224|Ga0079037_100075346 | All Organisms → cellular organisms → Bacteria | 2745 | Open in IMG/M |
| 3300006358|Ga0068871_101493155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300006572|Ga0074051_11747709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1126 | Open in IMG/M |
| 3300006573|Ga0074055_11022855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 788 | Open in IMG/M |
| 3300006573|Ga0074055_11136523 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300006573|Ga0074055_11423964 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300006579|Ga0074054_12088787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1245 | Open in IMG/M |
| 3300006579|Ga0074054_12138340 | All Organisms → cellular organisms → Bacteria | 3700 | Open in IMG/M |
| 3300006605|Ga0074057_11471983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 623 | Open in IMG/M |
| 3300006605|Ga0074057_12097452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300006605|Ga0074057_12101528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300006791|Ga0066653_10743918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300006794|Ga0066658_10061539 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300006796|Ga0066665_10802847 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300006796|Ga0066665_11593163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300006797|Ga0066659_10036709 | All Organisms → cellular organisms → Bacteria | 2986 | Open in IMG/M |
| 3300006806|Ga0079220_11012586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
| 3300006852|Ga0075433_10003733 | All Organisms → cellular organisms → Bacteria | 11783 | Open in IMG/M |
| 3300006852|Ga0075433_10855786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 794 | Open in IMG/M |
| 3300006854|Ga0075425_102258640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300006865|Ga0073934_10003669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 27632 | Open in IMG/M |
| 3300006865|Ga0073934_10004656 | All Organisms → cellular organisms → Bacteria | 22389 | Open in IMG/M |
| 3300006865|Ga0073934_10071416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2818 | Open in IMG/M |
| 3300006865|Ga0073934_10176306 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300006876|Ga0079217_10833618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300006881|Ga0068865_101046922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
| 3300006894|Ga0079215_10368007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
| 3300006945|Ga0073933_1013150 | All Organisms → cellular organisms → Bacteria | 3404 | Open in IMG/M |
| 3300006953|Ga0074063_12676412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300007790|Ga0105679_10143062 | All Organisms → cellular organisms → Bacteria | 3206 | Open in IMG/M |
| 3300009012|Ga0066710_100007175 | All Organisms → cellular organisms → Bacteria | 10592 | Open in IMG/M |
| 3300009012|Ga0066710_100148306 | All Organisms → cellular organisms → Bacteria | 3256 | Open in IMG/M |
| 3300009012|Ga0066710_100459059 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300009012|Ga0066710_100490525 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300009037|Ga0105093_10375884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300009053|Ga0105095_10083007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1732 | Open in IMG/M |
| 3300009078|Ga0105106_10613078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300009078|Ga0105106_10645260 | Not Available | 757 | Open in IMG/M |
| 3300009087|Ga0105107_10088846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2176 | Open in IMG/M |
| 3300009090|Ga0099827_10312660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1331 | Open in IMG/M |
| 3300009090|Ga0099827_10398384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1176 | Open in IMG/M |
| 3300009091|Ga0102851_10445826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1316 | Open in IMG/M |
| 3300009091|Ga0102851_11850261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300009098|Ga0105245_10639541 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300009098|Ga0105245_12843254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300009131|Ga0115027_11705378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300009137|Ga0066709_100008893 | All Organisms → cellular organisms → Bacteria | 8935 | Open in IMG/M |
| 3300009137|Ga0066709_100016471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7172 | Open in IMG/M |
| 3300009137|Ga0066709_101284623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
| 3300009137|Ga0066709_101676749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 904 | Open in IMG/M |
| 3300009162|Ga0075423_11658523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300009167|Ga0113563_10736036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
| 3300009789|Ga0126307_10472537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1012 | Open in IMG/M |
| 3300009803|Ga0105065_1087754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300009815|Ga0105070_1000665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4269 | Open in IMG/M |
| 3300009873|Ga0131077_10024452 | All Organisms → cellular organisms → Bacteria | 10025 | Open in IMG/M |
| 3300009943|Ga0117933_1410896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1103 | Open in IMG/M |
| 3300010038|Ga0126315_10429593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
| 3300010040|Ga0126308_11201001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300010041|Ga0126312_10881875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300010044|Ga0126310_10023746 | All Organisms → cellular organisms → Bacteria | 3114 | Open in IMG/M |
| 3300010044|Ga0126310_10337781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1051 | Open in IMG/M |
| 3300010045|Ga0126311_11593952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300010166|Ga0126306_10937351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300010313|Ga0116211_1081909 | Not Available | 854 | Open in IMG/M |
| 3300010326|Ga0134065_10457799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300010359|Ga0126376_10575133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
| 3300010362|Ga0126377_10852655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300010373|Ga0134128_12639747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300010398|Ga0126383_12624979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300010403|Ga0134123_10894119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 893 | Open in IMG/M |
| 3300011003|Ga0138514_100085237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300011119|Ga0105246_11463757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300011264|Ga0151623_1188412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300011435|Ga0137426_1150801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300012022|Ga0120191_10010406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1142 | Open in IMG/M |
| 3300012200|Ga0137382_10094888 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300012201|Ga0137365_11006965 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012204|Ga0137374_10000406 | All Organisms → cellular organisms → Bacteria | 42948 | Open in IMG/M |
| 3300012204|Ga0137374_10098735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2761 | Open in IMG/M |
| 3300012206|Ga0137380_10144923 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
| 3300012206|Ga0137380_10541503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
| 3300012208|Ga0137376_10316135 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300012209|Ga0137379_10748627 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300012212|Ga0150985_103203039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300012212|Ga0150985_107862301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
| 3300012285|Ga0137370_10712767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300012349|Ga0137387_10381114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1022 | Open in IMG/M |
| 3300012354|Ga0137366_11248886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300012355|Ga0137369_10121895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2108 | Open in IMG/M |
| 3300012360|Ga0137375_10105652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2855 | Open in IMG/M |
| 3300012902|Ga0157291_10094738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300012931|Ga0153915_10006043 | All Organisms → cellular organisms → Bacteria | 11314 | Open in IMG/M |
| 3300012931|Ga0153915_11030455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 959 | Open in IMG/M |
| 3300012944|Ga0137410_10696913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 846 | Open in IMG/M |
| 3300012951|Ga0164300_10703146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300012957|Ga0164303_10018495 | All Organisms → cellular organisms → Bacteria | 2633 | Open in IMG/M |
| 3300012957|Ga0164303_10370509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 873 | Open in IMG/M |
| 3300012964|Ga0153916_13003427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300012971|Ga0126369_12284802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300012984|Ga0164309_11307483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300012985|Ga0164308_11474337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
| 3300012985|Ga0164308_11595444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300012987|Ga0164307_10397413 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300013308|Ga0157375_11135030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 916 | Open in IMG/M |
| 3300013503|Ga0120127_10114644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300014166|Ga0134079_10320924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
| 3300014259|Ga0075311_1083027 | Not Available | 664 | Open in IMG/M |
| 3300014299|Ga0075303_1017610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
| 3300014318|Ga0075351_1006327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1595 | Open in IMG/M |
| 3300014318|Ga0075351_1048394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300014318|Ga0075351_1157223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300014321|Ga0075353_1191944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300014324|Ga0075352_1229076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300014324|Ga0075352_1243954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300015358|Ga0134089_10079431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1234 | Open in IMG/M |
| 3300015372|Ga0132256_100334025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1607 | Open in IMG/M |
| 3300015372|Ga0132256_101112223 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300015372|Ga0132256_102543438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300015372|Ga0132256_103035769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
| 3300015373|Ga0132257_101938651 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300017792|Ga0163161_10943796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
| 3300017792|Ga0163161_11020105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300017944|Ga0187786_10483232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300017947|Ga0187785_10000657 | All Organisms → cellular organisms → Bacteria | 12615 | Open in IMG/M |
| 3300017947|Ga0187785_10015193 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
| 3300017966|Ga0187776_10239483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1156 | Open in IMG/M |
| 3300017966|Ga0187776_10330332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1000 | Open in IMG/M |
| 3300018027|Ga0184605_10002560 | All Organisms → cellular organisms → Bacteria | 6154 | Open in IMG/M |
| 3300018027|Ga0184605_10022240 | All Organisms → cellular organisms → Bacteria | 2557 | Open in IMG/M |
| 3300018027|Ga0184605_10106328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1242 | Open in IMG/M |
| 3300018027|Ga0184605_10153316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1038 | Open in IMG/M |
| 3300018028|Ga0184608_10000343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12180 | Open in IMG/M |
| 3300018031|Ga0184634_10003034 | All Organisms → cellular organisms → Bacteria | 5319 | Open in IMG/M |
| 3300018032|Ga0187788_10023546 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300018055|Ga0184616_10335227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300018060|Ga0187765_11057815 | Not Available | 560 | Open in IMG/M |
| 3300018061|Ga0184619_10006319 | All Organisms → cellular organisms → Bacteria | 4486 | Open in IMG/M |
| 3300018071|Ga0184618_10402215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300018073|Ga0184624_10035857 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300018074|Ga0184640_10000250 | All Organisms → cellular organisms → Bacteria | 13365 | Open in IMG/M |
| 3300018079|Ga0184627_10583551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300018089|Ga0187774_11267747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300018422|Ga0190265_10148545 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
| 3300018431|Ga0066655_10011556 | All Organisms → cellular organisms → Bacteria | 3848 | Open in IMG/M |
| 3300018433|Ga0066667_10425787 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300018433|Ga0066667_10539833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 966 | Open in IMG/M |
| 3300018465|Ga0190269_11885311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300018466|Ga0190268_10034468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1838 | Open in IMG/M |
| 3300018466|Ga0190268_10071159 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300018466|Ga0190268_10455401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 849 | Open in IMG/M |
| 3300018466|Ga0190268_12057238 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018469|Ga0190270_11349941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300018469|Ga0190270_12149209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300018476|Ga0190274_11332716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300018482|Ga0066669_10205130 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300018482|Ga0066669_10437520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
| 3300018482|Ga0066669_10868570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300018482|Ga0066669_11214569 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300019356|Ga0173481_10018837 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300019356|Ga0173481_10507670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300019356|Ga0173481_10747549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300019362|Ga0173479_10172071 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300019362|Ga0173479_10560788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300021063|Ga0206227_1117734 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300021078|Ga0210381_10282765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300021082|Ga0210380_10178909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
| 3300021184|Ga0196959_10024029 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300021184|Ga0196959_10108129 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300021316|Ga0210351_1347061 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300021337|Ga0210341_1716518 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300021415|Ga0193694_1003332 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| 3300021418|Ga0193695_1026339 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300022213|Ga0224500_10086482 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300022554|Ga0212093_1001375 | All Organisms → cellular organisms → Bacteria | 70903 | Open in IMG/M |
| 3300022756|Ga0222622_10907630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300023266|Ga0247789_1084894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300024187|Ga0247672_1069595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300025159|Ga0209619_10181877 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300025159|Ga0209619_10407653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
| 3300025160|Ga0209109_10324142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300025164|Ga0209521_10045935 | All Organisms → cellular organisms → Bacteria | 2963 | Open in IMG/M |
| 3300025167|Ga0209642_10781076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300025310|Ga0209172_10002773 | All Organisms → cellular organisms → Bacteria | 29398 | Open in IMG/M |
| 3300025310|Ga0209172_10008975 | All Organisms → cellular organisms → Bacteria | 9515 | Open in IMG/M |
| 3300025310|Ga0209172_10129941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1404 | Open in IMG/M |
| 3300025313|Ga0209431_10137570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1932 | Open in IMG/M |
| 3300025322|Ga0209641_10314239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1149 | Open in IMG/M |
| 3300025327|Ga0209751_10887114 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300025521|Ga0210083_1004973 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300025537|Ga0210061_1004062 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300025549|Ga0210094_1013644 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300025885|Ga0207653_10186956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300025899|Ga0207642_10028425 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300025899|Ga0207642_10033231 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300025910|Ga0207684_10231642 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300025921|Ga0207652_11761444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300025922|Ga0207646_10855381 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300025922|Ga0207646_10897135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300025932|Ga0207690_10746440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300025934|Ga0207686_10086218 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300025936|Ga0207670_10240159 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300025937|Ga0207669_11951424 | Not Available | 502 | Open in IMG/M |
| 3300025939|Ga0207665_10087333 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300025945|Ga0207679_10289940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1407 | Open in IMG/M |
| 3300025960|Ga0207651_10775487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300025971|Ga0210102_1139241 | Not Available | 520 | Open in IMG/M |
| 3300025993|Ga0208415_1009293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
| 3300026023|Ga0207677_11802085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300026075|Ga0207708_10774660 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300026078|Ga0207702_11345479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300026089|Ga0207648_11671340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300026095|Ga0207676_10910655 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300026121|Ga0207683_10330091 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300026452|Ga0256821_1020562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300026536|Ga0209058_1263579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300026542|Ga0209805_1116056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1268 | Open in IMG/M |
| 3300026746|Ga0207454_102608 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300026747|Ga0207587_102346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300027032|Ga0209877_1016524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300027639|Ga0209387_1098803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
| 3300027647|Ga0214468_1035303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1326 | Open in IMG/M |
| 3300027713|Ga0209286_1035357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1864 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10012744 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10022188 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300027818|Ga0209706_10045522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2215 | Open in IMG/M |
| 3300027870|Ga0209023_10076402 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
| 3300027882|Ga0209590_10232659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1172 | Open in IMG/M |
| 3300027882|Ga0209590_10470766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300027915|Ga0209069_10189858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
| 3300027979|Ga0209705_10147399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_19FT_COMBO_70_19 | 1261 | Open in IMG/M |
| 3300028380|Ga0268265_12317301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 544 | Open in IMG/M |
| 3300028589|Ga0247818_11140900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300028712|Ga0307285_10144993 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300028717|Ga0307298_10066477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
| 3300028744|Ga0307318_10077002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1117 | Open in IMG/M |
| 3300028744|Ga0307318_10242604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300028771|Ga0307320_10211413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
| 3300028782|Ga0307306_10029267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1299 | Open in IMG/M |
| 3300028784|Ga0307282_10079848 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300028784|Ga0307282_10607724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300028793|Ga0307299_10393084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300028802|Ga0307503_10167549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
| 3300028802|Ga0307503_10188521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
| 3300028802|Ga0307503_10386820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300028802|Ga0307503_10496971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300028802|Ga0307503_10511900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
| 3300028802|Ga0307503_10732666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300028803|Ga0307281_10292834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300028807|Ga0307305_10478756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300028814|Ga0307302_10264928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300028819|Ga0307296_10299938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
| 3300028824|Ga0307310_10064988 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300028876|Ga0307286_10210856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
| 3300028876|Ga0307286_10397550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300028880|Ga0307300_10179388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
| 3300028881|Ga0307277_10431136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300029977|Ga0272449_1039790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2327 | Open in IMG/M |
| 3300030006|Ga0299907_10000016 | All Organisms → cellular organisms → Bacteria | 48860 | Open in IMG/M |
| 3300030006|Ga0299907_10063994 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300030006|Ga0299907_11041214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300030336|Ga0247826_10156374 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300030336|Ga0247826_10415882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
| 3300030613|Ga0299915_10156768 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300030613|Ga0299915_10487143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300030619|Ga0268386_10339992 | Not Available | 1073 | Open in IMG/M |
| 3300030620|Ga0302046_11261247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300031093|Ga0308197_10190450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300031170|Ga0307498_10127007 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031170|Ga0307498_10480367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300031199|Ga0307495_10170512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300031366|Ga0307506_10041410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1294 | Open in IMG/M |
| 3300031366|Ga0307506_10118689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
| 3300031421|Ga0308194_10116070 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300031455|Ga0307505_10144670 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300031548|Ga0307408_101221887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300031576|Ga0247727_10003705 | All Organisms → cellular organisms → Bacteria | 33458 | Open in IMG/M |
| 3300031576|Ga0247727_10027844 | All Organisms → cellular organisms → Bacteria | 7999 | Open in IMG/M |
| 3300031720|Ga0307469_10911745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 815 | Open in IMG/M |
| 3300031720|Ga0307469_12059458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300031740|Ga0307468_102153877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300031834|Ga0315290_10178313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1839 | Open in IMG/M |
| 3300031873|Ga0315297_10358013 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300031908|Ga0310900_10406849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
| 3300031949|Ga0214473_10013157 | All Organisms → cellular organisms → Bacteria | 9695 | Open in IMG/M |
| 3300031949|Ga0214473_10089567 | All Organisms → cellular organisms → Bacteria | 3595 | Open in IMG/M |
| 3300031949|Ga0214473_10102476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3342 | Open in IMG/M |
| 3300031949|Ga0214473_10103492 | All Organisms → cellular organisms → Bacteria | 3325 | Open in IMG/M |
| 3300031949|Ga0214473_10175686 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
| 3300031949|Ga0214473_10176622 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
| 3300031949|Ga0214473_10580615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
| 3300031949|Ga0214473_10616248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
| 3300031949|Ga0214473_10647739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
| 3300031949|Ga0214473_11708818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300031949|Ga0214473_11957458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300031949|Ga0214473_12163709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300031965|Ga0326597_10142460 | All Organisms → cellular organisms → Bacteria | 2870 | Open in IMG/M |
| 3300031965|Ga0326597_10556846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1236 | Open in IMG/M |
| 3300031965|Ga0326597_10904794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 902 | Open in IMG/M |
| 3300031965|Ga0326597_12017561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300032126|Ga0307415_100623208 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300032163|Ga0315281_10318913 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300032174|Ga0307470_11239075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300032177|Ga0315276_10382909 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300032256|Ga0315271_10136810 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300032516|Ga0315273_11655525 | Not Available | 778 | Open in IMG/M |
| 3300032770|Ga0335085_10020709 | All Organisms → cellular organisms → Bacteria | 9391 | Open in IMG/M |
| 3300033004|Ga0335084_10142503 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300033004|Ga0335084_11769178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300033233|Ga0334722_10087584 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300033233|Ga0334722_10960733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300033407|Ga0214472_10183657 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300033416|Ga0316622_100719465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1156 | Open in IMG/M |
| 3300033433|Ga0326726_10043627 | All Organisms → cellular organisms → Bacteria | 3918 | Open in IMG/M |
| 3300033433|Ga0326726_10224917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1740 | Open in IMG/M |
| 3300033485|Ga0316626_10632216 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300033489|Ga0299912_10325481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_19FT_COMBO_70_19 | 1281 | Open in IMG/M |
| 3300033521|Ga0316616_102592276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300033551|Ga0247830_11608120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300034099|Ga0373902_083683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300034155|Ga0370498_002791 | All Organisms → cellular organisms → Bacteria | 3929 | Open in IMG/M |
| 3300034176|Ga0364931_0182529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 3.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.33% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 2.14% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.90% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.90% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.90% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.43% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.19% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.19% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.48% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.48% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.48% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.48% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.48% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.48% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.48% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.48% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.24% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.24% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.24% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment | 0.24% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.24% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.24% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.24% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.24% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment | 0.24% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.24% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.24% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.24% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.24% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.24% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.24% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.24% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002149 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006945 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC16 2012 metaG | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300009943 | Combined Assembly of Gp0139325, Gp0139347, Gp0139348 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010313 | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011264 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300021316 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021337 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022554 | Dewar_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025521 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026746 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026747 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A3-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029977 | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-024-1 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034099 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3 | Engineered | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_DRAFT_00335590 | 2088090008 | Soil | VGFNAMQPGKIKKGDIVMLVAAIVVVFALIFWAVR |
| Perma_A_C_03197950 | 2124908032 | Soil | MGFNAMQPGKTKRGDLLFLAAAVIVVGILLAWAFFG |
| A2_c1_00271040 | 2124908043 | Soil | VGFNAMQPGKIKKGDIVMLGAAVIVVLALIIWAVR |
| A5_c1_00425850 | 2124908044 | Soil | VGFNAMQPGKIKKGDIVMLVAAVIVVLALIIWAVR |
| KansclcFeb2_07357760 | 2124908045 | Soil | VGFNAMRPGKVKAADLVMLVAAIVVIVALVIWAIR |
| deepsgr_01756500 | 2199352025 | Soil | MGFNAMQPGKVKRADLLFLIAAVIVIGALLAWAFFGS |
| INPhiseqgaiiFebDRAFT_1016212903 | 3300000364 | Soil | VGFNAMQPGKVKRSDLLYLVAAVVVIGLLLAWAFFGT* |
| F24TB_106719842 | 3300000550 | Soil | MGFNAMQPGKVKRGDLLYLVAALIVIGLLLAWAFFGT* |
| F14TC_1025568992 | 3300000559 | Soil | VGFNAMQPGKVKRGDLLYLVAALIVIGLLLAWAFFGT* |
| JGI10214J12806_109081552 | 3300000891 | Soil | MGFNAMQPGKVKRGDLLFLIAAVIVVGALLAWAFFGS* |
| JGI10216J12902_1000332203 | 3300000956 | Soil | SRNRRTEHMGFNAMQPGKIKRGDLLYLVVALIVIGLLLAWAFFGS* |
| JGI10216J12902_1001712493 | 3300000956 | Soil | MGFNAMQPGKIKRGDVLYLVVALIVIGLLLAWAFFGT* |
| JGI10216J12902_1007682423 | 3300000956 | Soil | MGFNAMQPGKVKRGDLLFLLAAVIVIGALLAWAFFGS |
| JGI10216J12902_1126907063 | 3300000956 | Soil | VGFNAMQPGKVKRGDLLFLLAAIVVVVALVVWALTA* |
| JGI10216J12902_1167584733 | 3300000956 | Soil | MGFNAMQPGKVRRGDLLFLIAAILVVTLLVLWAVRA* |
| C688J13580_10019871 | 3300001205 | Soil | VGFNAMQPGKIKRGDLIFLIAAIVVIGALIAWALFGS* |
| JGIcombinedJ13530_1074139153 | 3300001213 | Wetland | VGFNAMQPGKIKKGDLLYLLAAIVVIGALVIWALR* |
| A10PFW1_102889944 | 3300001538 | Permafrost | MGFNYQQPGKIKRADWIMLIAAVVVIAGLIVWATR* |
| C688J18823_103417653 | 3300001686 | Soil | MGFNAMQPGKVKRFDLIMLISAIVVVGALVFWAVH* |
| RCM39_10162612 | 3300001837 | Marine Plankton | VGFNAMRPGKVKRGDVLYLLAAVVVIAALVLWAVR* |
| RCM31_102543622 | 3300001851 | Marine Plankton | VGFNAMRPGKVKRGDLLYLLAAVVVIAALVLWAVR* |
| C687J26616_100007652 | 3300002120 | Soil | MGFNAMQPGKIKPADLLYLLAAVVVIGGLIWWAVS* |
| C687J26657_100716292 | 3300002149 | Soil | MGFNAMQPGKIKRGDLLYLLSAIVVVVGLIVWAVR* |
| Ga0070689_1011878473 | 3300005340 | Switchgrass Rhizosphere | MGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFRVSAVADL |
| Ga0070708_1011152963 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGMGFNAMQPGKVKRGDLLFLIVALIVIGALVAWAFFGT* |
| Ga0073909_100044254 | 3300005526 | Surface Soil | MGFNAMQPGKVKRGDLLFLIAAVIVIGALLAWAFFGS* |
| Ga0073909_103011653 | 3300005526 | Surface Soil | VGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFG* |
| Ga0070741_1000247051 | 3300005529 | Surface Soil | MGFNAMQPGKIKRADLVMLVCAVLVIAGLVAWAVR* |
| Ga0070741_100210718 | 3300005529 | Surface Soil | MGFNAMQPGKIKRADLVMLVCAVIVIAGLVVWAVR* |
| Ga0070741_100492267 | 3300005529 | Surface Soil | MGFNAMQPGKVRRADLVMLVCAILVIAGLVAWAVR* |
| Ga0066697_102825742 | 3300005540 | Soil | MGFNAMQPGKVKRGDLLFLIVALIVIGALLAWAFFGS* |
| Ga0070672_1015408993 | 3300005543 | Miscanthus Rhizosphere | VGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVR* |
| Ga0070665_1003271483 | 3300005548 | Switchgrass Rhizosphere | MGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL* |
| Ga0066701_100784134 | 3300005552 | Soil | MGFNAMQPGRVKRGDLVFLIVAVIVIGALVAWAFFGS* |
| Ga0066695_100114355 | 3300005553 | Soil | MGFNAMQPGKVKPGDLLFLIVALIVIGALLAWAFFGS* |
| Ga0066695_101145414 | 3300005553 | Soil | MGFNTMQPGKVKRGDLLYLVAALIVIGLLLAWAFFGT* |
| Ga0066700_101502072 | 3300005559 | Soil | MGFNAMRPGRVRRGDLIMLLAAIVIVAALVYWAVH* |
| Ga0066699_107362751 | 3300005561 | Soil | MGFNAMRPGRVKGGDLLMLLAAIVIVGALVFWAVR* |
| Ga0070664_1007142903 | 3300005564 | Corn Rhizosphere | MGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG* |
| Ga0070664_1023524611 | 3300005564 | Corn Rhizosphere | MGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGS* |
| Ga0068857_1020439712 | 3300005577 | Corn Rhizosphere | VTVGFNAMQPGRIKRGDLWYLVAAIVVIGALVIWAVR* |
| Ga0068854_1003991363 | 3300005578 | Corn Rhizosphere | MGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGL* |
| Ga0066654_101047422 | 3300005587 | Soil | VGFNAMQPGKLKRGDLIFLIAAIVVIGALLAWALFG* |
| Ga0066706_105569513 | 3300005598 | Soil | LGFNAMRPGRVKGADLLMLLAAIVIVGALVFWAVR* |
| Ga0066706_113308181 | 3300005598 | Soil | MGFNAMQPGKVKRGDLLFLVVALIVIGALLAWAFFGS* |
| Ga0068856_1015813211 | 3300005614 | Corn Rhizosphere | VGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGS* |
| Ga0068859_1030295072 | 3300005617 | Switchgrass Rhizosphere | VGFNAMQPGKIKKGDFVMLVAAIVVVLALVIWAVR* |
| Ga0068866_100214813 | 3300005718 | Miscanthus Rhizosphere | MGFNAMQPGKVKRADLLFLIAAMIVVGALLAWAFFGS* |
| Ga0068866_100321313 | 3300005718 | Miscanthus Rhizosphere | VGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWALFGS* |
| Ga0066903_1002060624 | 3300005764 | Tropical Forest Soil | VGFNAMQPGKIKRGDLIFLIAAIVVIAALLAWAFFGL* |
| Ga0066903_1020089663 | 3300005764 | Tropical Forest Soil | MGFNAMQPGKIKKGDLIFFVSGLVVILALVIWAIR* |
| Ga0066903_1023009411 | 3300005764 | Tropical Forest Soil | TMGFNAMQPGKIKKGDIIFFVSGLVVILALVIWAIR* |
| Ga0066903_1025007162 | 3300005764 | Tropical Forest Soil | MGFNAMQPGKVKRGDLLFLIAALIVIGLLLAWAFFGT* |
| Ga0066903_1034040602 | 3300005764 | Tropical Forest Soil | MGFNAMQPGKVKRGDLLYLVAALIVIGLLLAWAFFGH* |
| Ga0066903_1046199352 | 3300005764 | Tropical Forest Soil | MGFNAMQPGKVKRGDLVYLVVALVVIGLLLAWAFFGT* |
| Ga0068851_104824274 | 3300005834 | Corn Rhizosphere | SRRGSAMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL* |
| Ga0074470_101700095 | 3300005836 | Sediment (Intertidal) | MGFNAMQPGKIKRGDVLFLLAAVIVIGALLAWAFLG* |
| Ga0074470_1095539411 | 3300005836 | Sediment (Intertidal) | MGFNAMQPGKIKRGDLLFLLAAVIVIGALLAWAFLG* |
| Ga0068870_103239182 | 3300005840 | Miscanthus Rhizosphere | VGFNYQQPGKIKRGDWIMLIAAVVVVAALVIWAVR* |
| Ga0068863_1006733701 | 3300005841 | Switchgrass Rhizosphere | RRGSAMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL* |
| Ga0068860_1021903202 | 3300005843 | Switchgrass Rhizosphere | MGFNAMQPGRVKRGDLLFLIAAVIVIGALLAWAFFGS* |
| Ga0068862_1024020632 | 3300005844 | Switchgrass Rhizosphere | VGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVR* |
| Ga0068862_1026745762 | 3300005844 | Switchgrass Rhizosphere | MGFNAMQPGRIKRGDVIFLIAAIVVIGALLAWAFFGL* |
| Ga0075288_10020052 | 3300005874 | Rice Paddy Soil | MGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAVR* |
| Ga0075291_10104401 | 3300005884 | Rice Paddy Soil | DDMGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAVR* |
| Ga0075286_10080104 | 3300005886 | Rice Paddy Soil | MGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAAR* |
| Ga0081539_100183033 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MGFNAMQPGRIKRGDLLLLVAAVVIVGALIAWALFGS* |
| Ga0081539_100650142 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MGFNAMQPGKVKPGDIAFLVAAIVVIAALVFWAVR* |
| Ga0066651_103246373 | 3300006031 | Soil | VGFNAMQPGKIKRGDLIFLIAAIAVIGALLAWAFFGL* |
| Ga0066651_103290103 | 3300006031 | Soil | MGFNAMQPGKIKRGDLLFLLAAIVVIAALVAWALWS* |
| Ga0066652_1000474034 | 3300006046 | Soil | MGFNAMQPGKVKRADLIMLICAVIVVGALVFWAVH* |
| Ga0066652_1001581892 | 3300006046 | Soil | MGFNAMQPGKVKRGDLLFLIAAVIVIGLLVAWAFFGS* |
| Ga0066652_1006714134 | 3300006046 | Soil | MGFNAMQPGKIKRGDIIMLVSGIVVIVALIVWAVR* |
| Ga0066652_1007689732 | 3300006046 | Soil | VGFNAMQPGKIKRGDLLFLLAAVVVVAALVIWATWS* |
| Ga0075024_1000780772 | 3300006047 | Watersheds | VGFNAMQPGKIKKGDVIMLVAAVVVFAALIVWAVR* |
| Ga0070716_1007365102 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFNAMQPGKVKRGDLLFLIVALIVIGALVAWAFFGT* |
| Ga0070716_1017601522 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VGFNAMQPGKVKRADLIMLLCAVVVVGALIFWAVH* |
| Ga0070712_1007649182 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFNAMQPGKVKRGDLLFLIAAVIVIGVLVAWALFGS* |
| Ga0079037_1000269531 | 3300006224 | Freshwater Wetlands | VGFNAMQPGKIKKGDLVFLVAAIVVTGALLAWALF |
| Ga0079037_1000753465 | 3300006224 | Freshwater Wetlands | VGFNAMQPGKIKRGDLLYLLAAVVIIVALVLWAIS* |
| Ga0068871_1014931552 | 3300006358 | Miscanthus Rhizosphere | VGFNYQQPGKIKRGDWIMLIAAVVVVAGLVIWAVR* |
| Ga0074051_117477093 | 3300006572 | Soil | MGFNAMQPGRIKRGDLLFLVAAIVVVGVLLAWAFFGT* |
| Ga0074055_110228552 | 3300006573 | Soil | VGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVH* |
| Ga0074055_111365234 | 3300006573 | Soil | MGFNAMQPGKVKRADLLFLIAAVIVIGALLAWAFFGS* |
| Ga0074055_114239644 | 3300006573 | Soil | MGFNAMQPGRIKRADLLYLVAAIVVIGALLAWAFLGR* |
| Ga0074054_120887874 | 3300006579 | Soil | MQPGKIKRGDLVFLIAAIVVIGALLAWAFFGSCRRSTRPR |
| Ga0074054_121383405 | 3300006579 | Soil | MGFNAMQPGKVKRADLLFLIAAVIVIGALLVWAFFGS* |
| Ga0074057_114719833 | 3300006605 | Soil | MGFNAMQPGKVKRGDLVFLVAAVIVIGLLVAWAFFGS* |
| Ga0074057_120974521 | 3300006605 | Soil | MGFNAMQPGRIKRGDLLFLVAAIVVVGVLLAWAFF |
| Ga0074057_121015284 | 3300006605 | Soil | VGFNAMQPGKIKRGDIIMLVAAIVVVLALVIWAVR* |
| Ga0066653_107439181 | 3300006791 | Soil | MGFNAMQPGKVKRGDLLYLLVALIVIGLLLAWAFFGT* |
| Ga0066658_100615392 | 3300006794 | Soil | MGFNAMQPGKVKRADLIMLICAVVVVGALIFWAVH* |
| Ga0066665_108028473 | 3300006796 | Soil | MGFNAMQPGKVKRGDLLFLIVALIVIGALVAWAFFGS* |
| Ga0066665_115931632 | 3300006796 | Soil | MGFNAKQPGKVKRGDLVFLSAAVIVIGVLVAWAFFGS* |
| Ga0066659_100367092 | 3300006797 | Soil | MGFNAMQPGKVKRGDLLFLIVAVIVIGALVAWAFFGS* |
| Ga0066660_105196732 | 3300006800 | Soil | LGFNAMRPGRVRKGDVIMLVSAIAVIAALVIWAVR* |
| Ga0079220_110125862 | 3300006806 | Agricultural Soil | VGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGS* |
| Ga0075433_100037338 | 3300006852 | Populus Rhizosphere | MGFNAMQPGKIKRGDLLYLVVALIVIGLLLAWAFFGS* |
| Ga0075433_108557862 | 3300006852 | Populus Rhizosphere | MGFNAMQPGKVKRGDLVYLVVALVVIGLLLAWAFFGS* |
| Ga0075425_1022586402 | 3300006854 | Populus Rhizosphere | MGFNAMQPGKIKKGDIIFFVSGLVVILALVIWAIR* |
| Ga0073934_100036695 | 3300006865 | Hot Spring Sediment | MGFNAMQPGKVKRGDLLYLLAALIVIVGLVVWAVR* |
| Ga0073934_100046564 | 3300006865 | Hot Spring Sediment | VGFNAMQPGKIKRGDLLYLAAGILVIVALVLWAIL* |
| Ga0073934_100714164 | 3300006865 | Hot Spring Sediment | MGFNAMQPGKVKRADLIMLLSALAVLVALVVWALR* |
| Ga0073934_101763063 | 3300006865 | Hot Spring Sediment | MGFNAMQPGKVKRGDLLYLLAAVIVIVGMIVWAVR* |
| Ga0079217_108336182 | 3300006876 | Agricultural Soil | VGFNAMQPGKTKRGDIIMLVAAIVLFGGALVWALR* |
| Ga0068865_1010469222 | 3300006881 | Miscanthus Rhizosphere | VGFNAMQPGRIKRGDLWYLVAAIVVIGALVIWAVR* |
| Ga0079215_103680071 | 3300006894 | Agricultural Soil | VGFNTMRPGKVKRGDLLYLIAAIVVIAALVIWAVR* |
| Ga0073933_10131503 | 3300006945 | Hot Spring Sediment | MGFNAMRPGKVKRGDLLYLAAALIVMAALVIWAVR* |
| Ga0074063_126764122 | 3300006953 | Soil | VGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVH* |
| Ga0105679_101430622 | 3300007790 | Soil | MGFNAMRPGKVKRGDLIMFVAAVVVIVALVVWALL* |
| Ga0066710_1000071755 | 3300009012 | Grasslands Soil | MGFNAMQPGKVKRGDLVFLIAAVIVIGVLVAWAFFGS |
| Ga0066710_1001483067 | 3300009012 | Grasslands Soil | VGFNAMQPGKIKRADLIMLISAIVVIVALVVWAAH |
| Ga0066710_1004590594 | 3300009012 | Grasslands Soil | MGFNAMQPGKVKRGDLLFLIAAVIVIGLLIAWAFFGS |
| Ga0066710_1004905252 | 3300009012 | Grasslands Soil | MGFNAMQPGKVKRGDLVFLVAAVIVIGVLVAWAFFGS |
| Ga0066710_1046743032 | 3300009012 | Grasslands Soil | MGFNAMRPGRVKGGDLLMLLAAIVIVGALVFWAVR |
| Ga0105093_103758842 | 3300009037 | Freshwater Sediment | VGFNAMQPGKVKRGDLVYLIAAIVVIGALVAWALS* |
| Ga0105095_100830072 | 3300009053 | Freshwater Sediment | MGFNAMQPGKIKRGDLLYLAAGIAVIVALVLWAIL* |
| Ga0105106_106130783 | 3300009078 | Freshwater Sediment | VTVGFNAMQPGKVKRGDLLYLLAAIVVIAGLVVWAVR* |
| Ga0105106_106452601 | 3300009078 | Freshwater Sediment | MGFNAMRPGKVRKGDLLYLLAAVVVIGVLIVWAMS* |
| Ga0105107_100888463 | 3300009087 | Freshwater Sediment | VTVGFNAMQPGKVKRDDLLYLLAAIVVIVGLVVWAVR* |
| Ga0099827_103126603 | 3300009090 | Vadose Zone Soil | MGFNSMQPGKVKRGDLIMLAAALAVLVALVVWAVR* |
| Ga0099827_103983844 | 3300009090 | Vadose Zone Soil | MGFNAMQPGKVKRGDLLLLIVALIVIGALVAWAFFGS* |
| Ga0102851_104458263 | 3300009091 | Freshwater Wetlands | VTVGFNAMQPGKIKRGDLLYLLAAVVIIVALVLWAIS* |
| Ga0102851_118502612 | 3300009091 | Freshwater Wetlands | VTVGFNAMRPGKVRRGDLLYLLAAVVVIGGLIVWAVR* |
| Ga0105245_106395411 | 3300009098 | Miscanthus Rhizosphere | MGFNAMQPGKVKRADLIMLICAIVVVGALIFWAVH* |
| Ga0105245_128432541 | 3300009098 | Miscanthus Rhizosphere | MGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGS* |
| Ga0115027_117053783 | 3300009131 | Wetland | VGFNAMQPGKIKKGDLLFLVAAIVVTAALLAWAFFG* |
| Ga0066709_1000088939 | 3300009137 | Grasslands Soil | MGFNAMQPGKVKRGDLLFLIAAVIVIGLLIAWAFFGS* |
| Ga0066709_1000164719 | 3300009137 | Grasslands Soil | MGFNAMQPGKVKRGDLVFLIAAVIVIGVLVAWAFFGS* |
| Ga0066709_1012846233 | 3300009137 | Grasslands Soil | MGFNAMQPGKVKRGDLVFLVAAVIVIGVLVAWAFFGS* |
| Ga0066709_1016767491 | 3300009137 | Grasslands Soil | MGFNAMQPGRVKRGDLVFLIVALIVIGALVAWAFFGS* |
| Ga0075423_116585232 | 3300009162 | Populus Rhizosphere | MGFNAKQPGRVKRGDLLFLIAAVIVIGALLAWAFFGS* |
| Ga0113563_107360364 | 3300009167 | Freshwater Wetlands | VTVGFNAMRPGKVRRGDLLYLLAAAVVIGGLIIWAAR* |
| Ga0126307_104725373 | 3300009789 | Serpentine Soil | MGFNAMQPGKVNRGDILFLVTAIVVIAALVFWAVH* |
| Ga0105065_10877542 | 3300009803 | Groundwater Sand | EMGFNAMQPGKVKRADILMLVSAIVVIVALVVWAVR* |
| Ga0105061_10519803 | 3300009807 | Groundwater Sand | GFNAMRPGKVKAADLVMLVAAIVVIVALVIWAIR* |
| Ga0105070_10006654 | 3300009815 | Groundwater Sand | MGFNAMQPGKVKRADILMLVSAIVVIVALVVWAVR* |
| Ga0105078_10071933 | 3300009823 | Groundwater Sand | VGFNAMRPGKVRTADLVMLVAAIVVIVALVIWAVR* |
| Ga0105068_10736842 | 3300009836 | Groundwater Sand | VGFNAMRPGKIKKGDLIMLAAGILVLVGLVIWAIA* |
| Ga0105058_10067495 | 3300009837 | Groundwater Sand | VGFNAMRPGKVKAADLVMLVAAIVVIVALVIWAVR* |
| Ga0131077_100244526 | 3300009873 | Wastewater | MGFNAMQPGKIKKGDLLMLGAAVVVFVLLILWVAL* |
| Ga0117933_14108962 | 3300009943 | Hot Spring Fe-Si Sediment | MGFNAMRPGKVKRGDLLYLAAALVVMAALVIWAVR* |
| Ga0126315_104295934 | 3300010038 | Serpentine Soil | MGFNAMQPGKVNRGDILFLVSAIVVIAALVFWAVH* |
| Ga0126308_112010011 | 3300010040 | Serpentine Soil | MGFNAMQPGKVNRGDILFLVTAIVVMAVLELIVKR |
| Ga0126312_108818752 | 3300010041 | Serpentine Soil | MGFNAMQPGRIKRGDILYLVAAIVVIVGLIVWAVR* |
| Ga0126310_100237464 | 3300010044 | Serpentine Soil | VGFNYQQPGKIKRGDWIMLIAAVVIVAALVVWVVR* |
| Ga0126310_103377814 | 3300010044 | Serpentine Soil | VGFNAMQPGKIKRGDIIMLVAAIVIVVALVVWAIS* |
| Ga0126311_115939521 | 3300010045 | Serpentine Soil | RLSAVGFNAMQPGRIKRGDLLFLIAAIVVIGALIAWALFG* |
| Ga0126306_109373511 | 3300010166 | Serpentine Soil | MGFNYQQPGKIKRGDWIMLIAAVVVVVALTIWATR* |
| Ga0116211_10819092 | 3300010313 | Hot Spring | MGFNAMRPGRVKRGDLLYLLAAVVVVAALVFWAVR* |
| Ga0134065_104577992 | 3300010326 | Grasslands Soil | MGFNAMQPGKVKRGDLLFLIAAVIVIGLLVAWAFLGS* |
| Ga0126376_105751331 | 3300010359 | Tropical Forest Soil | VGFNAMQPGKIKRGDLIFLIAAIVVIGALLPWAFSG* |
| Ga0126377_108526552 | 3300010362 | Tropical Forest Soil | VGFNAMQPGRVKRGDLLYLIVAVIVIGLLLAWAFFGT* |
| Ga0134128_126397471 | 3300010373 | Terrestrial Soil | MGFNAMQPGKVKRADLIMLICAIVVVGVLIFWAVH* |
| Ga0126383_126249792 | 3300010398 | Tropical Forest Soil | VGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL* |
| Ga0134123_108941193 | 3300010403 | Terrestrial Soil | VGVNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVR* |
| Ga0138514_1000852372 | 3300011003 | Soil | MGFNAMQPGKVKRGDLLFLIAAVIVIGALVAWAFFGS* |
| Ga0105246_114637572 | 3300011119 | Miscanthus Rhizosphere | VGFNAMQPGKIKKGDIIMLVAAIVVVLALVIWAVR* |
| Ga0151623_11884122 | 3300011264 | Sediment | MGFNAMQPGKIKRSDLVMLLAAVVVVVALVVWATL* |
| Ga0137426_11508012 | 3300011435 | Soil | VGFNAMRPGKTKGADLLYLIAAFVVISALIWWAAS* |
| Ga0120191_100104061 | 3300012022 | Terrestrial | VGFNAMQPGKVKRADLLYLVAAIVVIVALIVWATR* |
| Ga0137382_100948884 | 3300012200 | Vadose Zone Soil | MGFNAMQPGKVKRGDLLLLIAAVIVIGALLAWAFFGS* |
| Ga0137365_110069653 | 3300012201 | Vadose Zone Soil | FNAMQPGKVKRGDLLLLIAAVIVIGLLLAWAFLGT* |
| Ga0137374_1000040616 | 3300012204 | Vadose Zone Soil | MGFNAMQPGKVRKGDIIMLVSAIAVVVGLVIWAIR* |
| Ga0137374_100987356 | 3300012204 | Vadose Zone Soil | MGFNAMRPGKVKRGDIIMLVSAIVVVAALIVWAVR* |
| Ga0137374_109140111 | 3300012204 | Vadose Zone Soil | VGFNAMRPGKVKAADLVMLLAAIVVIVALVIWAIR* |
| Ga0137380_101449234 | 3300012206 | Vadose Zone Soil | MGFNAMQPGKVKRGDLLFLIVALIVIGALIAWAFFGS* |
| Ga0137380_105415032 | 3300012206 | Vadose Zone Soil | MGFNAMQPGKVKRGDVIMLVAFVVIVGALIAWAVR* |
| Ga0137376_103161352 | 3300012208 | Vadose Zone Soil | MGFNAMQPGKVKRGDLLFLVAAVIVIGALVAWAFFGS* |
| Ga0137379_107486271 | 3300012209 | Vadose Zone Soil | VGFNAMQPGKVKKGDLVMLAAAIGVVIALIVWVVR* |
| Ga0150985_1032030392 | 3300012212 | Avena Fatua Rhizosphere | MGFNAMQPGKVKRSDLIMLVCAVVVVGALIFWAVH* |
| Ga0150985_1078623012 | 3300012212 | Avena Fatua Rhizosphere | MGFNAMQPGKIRKGDIIFFVSGLAVILALVIWAIR* |
| Ga0137370_107127673 | 3300012285 | Vadose Zone Soil | VGFNAMQPGRIKKGDVVMLVAALVVIVALIVWATR* |
| Ga0137387_103811142 | 3300012349 | Vadose Zone Soil | MGFNAMQPGEVKRGDLLFLIAAVIVIGLLIAWAFFGS* |
| Ga0137367_107439652 | 3300012353 | Vadose Zone Soil | VGFNAMGPGKVRAADLVMLVAAIVVIVALVIWAIR* |
| Ga0137366_112488862 | 3300012354 | Vadose Zone Soil | MGFNAMQPGKVKRGDLLYLLGALIVIGLLLAWAFFGT* |
| Ga0137369_101218955 | 3300012355 | Vadose Zone Soil | MGFNAMQPGKLKRGDLIMLIAAVVSVAALLIWALR* |
| Ga0137375_101056525 | 3300012360 | Vadose Zone Soil | VGFNAMQPGKVKRADLVMLIAAIVLIVGALVWALR* |
| Ga0137375_107341071 | 3300012360 | Vadose Zone Soil | REAEVGFNAMRPGKVKAADLVMLLAAIVVIVALVIWAIR* |
| Ga0157291_100947381 | 3300012902 | Soil | VGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWAFFG |
| Ga0153915_100060438 | 3300012931 | Freshwater Wetlands | MGFNAMRPGKIGRGDLLMLVAAIAVVAVLVIWAVR* |
| Ga0153915_110304554 | 3300012931 | Freshwater Wetlands | MGFNAMQPGKVKKGDLLYLLAAIVIIGSLIVWAVR* |
| Ga0137410_106969132 | 3300012944 | Vadose Zone Soil | MGFNAMQPGKIKKGDIVMLVAAIAIVLALIVWAVR* |
| Ga0164300_107031461 | 3300012951 | Soil | VGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFG* |
| Ga0164303_100184955 | 3300012957 | Soil | MGFNAMQPGKVKRGDLLVLIAAVIVIGALLAWAFFGS* |
| Ga0164303_103705091 | 3300012957 | Soil | MGFNAMQPGKVKRADLLFLIAAVIVVGALLAWAFFGS* |
| Ga0153916_130034272 | 3300012964 | Freshwater Wetlands | MGFNAMQPGKVKKGDLLYLLAAIVVIGGLIVWAVR* |
| Ga0126369_122848022 | 3300012971 | Tropical Forest Soil | MGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWALFG* |
| Ga0164309_113074832 | 3300012984 | Soil | MGFNAMQPGKIKKGDIVMLVAAHVIVIALIVWAVR* |
| Ga0164308_114743372 | 3300012985 | Soil | MGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFG* |
| Ga0164308_115954441 | 3300012985 | Soil | MGFNAMQPGKVKRADLLFLIAAVIVVGALLAWAFFGS |
| Ga0164307_103974131 | 3300012987 | Soil | DVGFNAMQPGKIKRGDLVLLIAAIVVIGALLAWAFFGS* |
| Ga0157375_111350303 | 3300013308 | Miscanthus Rhizosphere | VTVGFNATQPGRIKRGDLWYLVAAIVVIGALVIWAVR* |
| Ga0120127_101146442 | 3300013503 | Permafrost | VGFNAMQPGKIKKGDIVMLVAAIVVVLALIVWAVR* |
| Ga0134079_103209242 | 3300014166 | Grasslands Soil | MGFNAMQPGKVKRGDLLFLLAAVIVIGALLAWAFFGS* |
| Ga0075311_10830272 | 3300014259 | Natural And Restored Wetlands | LGFNAMQPGKIKRGDLWFLIAAIVVVAALLAWAFFG* |
| Ga0075303_10176103 | 3300014299 | Natural And Restored Wetlands | VGFNAMQPGRIKRSDLLFLVAAVVVIVALLIWVLAG* |
| Ga0075351_10063275 | 3300014318 | Natural And Restored Wetlands | VGFNAMQPGRIKRADLLYLLAAIAVIGALVWWAVS* |
| Ga0075351_10483943 | 3300014318 | Natural And Restored Wetlands | LGFNAMQPGRIKRADLLYLLGAIVVIGALIWWAVS* |
| Ga0075351_11572232 | 3300014318 | Natural And Restored Wetlands | VGFNAMQPGKIKKADLLYLLAAVVVIGALIAWAVR* |
| Ga0075353_11919443 | 3300014321 | Natural And Restored Wetlands | VGFNAMQPGKIKKADIVMLVAAAVVLVGLIVWAVR* |
| Ga0075352_12290761 | 3300014324 | Natural And Restored Wetlands | VGFNAMQPGKIKKADLLYLLAAIVVIGALIAWAVR* |
| Ga0075352_12439541 | 3300014324 | Natural And Restored Wetlands | VGFNAMQPGRIKRADLLYLLAAIVVIGVLIWWAVS* |
| Ga0134089_100794312 | 3300015358 | Grasslands Soil | MGFNAMQPGRVKRGDLVYLIVALIVIGLLLAWAFFGT* |
| Ga0132256_1003340253 | 3300015372 | Arabidopsis Rhizosphere | MGFNALQPGKIKKGDIVMLVAAIVIVIALIVWAVR* |
| Ga0132256_1011122231 | 3300015372 | Arabidopsis Rhizosphere | RRDSAMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFG* |
| Ga0132256_1025434382 | 3300015372 | Arabidopsis Rhizosphere | MGFNAMQPGRVKRGDLLFLIAAVLVIGALLAWAFFGS* |
| Ga0132256_1030357692 | 3300015372 | Arabidopsis Rhizosphere | MGFNAMQPGKVKKGDLLMLGAAVVVIVLLILWVAL* |
| Ga0132257_1019386513 | 3300015373 | Arabidopsis Rhizosphere | GFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFG* |
| Ga0134069_10099443 | 3300017654 | Grasslands Soil | VGFNAMRPGKVKAADIAMLVAAILVIVALVIWVIR |
| Ga0163161_109437962 | 3300017792 | Switchgrass Rhizosphere | VGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVR |
| Ga0163161_110201051 | 3300017792 | Switchgrass Rhizosphere | MGFNAMQPGKIKRGDVVFLIAAIVVIGALLAWAFFGS |
| Ga0187786_104832322 | 3300017944 | Tropical Peatland | VGFNAMQPGKIKRADLIMLVAAAVVIVALVVWAIH |
| Ga0187785_1000065712 | 3300017947 | Tropical Peatland | MGFNAMQPGRIKRGDLLFLVAAIVVVGVLLAWAFFGT |
| Ga0187785_100151936 | 3300017947 | Tropical Peatland | MGFNAMQPGKIKRGDLIMLVAAAVVIVALIAWAIR |
| Ga0187776_102394832 | 3300017966 | Tropical Peatland | VGFNAMQPGKIKRADLIMLVAAAVVIVALVVWAIR |
| Ga0187776_103303323 | 3300017966 | Tropical Peatland | MGFNAMQPGRVKRADLLFLVAAVVVIGLLLAWAFFGS |
| Ga0184605_100025606 | 3300018027 | Groundwater Sediment | VGFNAMQPGKIKRGDLLYLLAAIVVVAGLLVWVVR |
| Ga0184605_100222405 | 3300018027 | Groundwater Sediment | MGFNAMQPGKVKRGDLLFLIAAVIVIGVLLAWAFFGS |
| Ga0184605_101063284 | 3300018027 | Groundwater Sediment | VGFNAMQPGKIKKGDIVMLVAALVVIVALIVWATR |
| Ga0184605_101533163 | 3300018027 | Groundwater Sediment | VGFNAMQPGKIKKGDIVMLVAAIVVVLALIVWAIR |
| Ga0184608_100003432 | 3300018028 | Groundwater Sediment | MGFNAMQPGKVKRGDLLFLIAAVIVIGALLAWAFFGS |
| Ga0184634_100030349 | 3300018031 | Groundwater Sediment | MGFNAMQPGKVKRGDILMLVSAIVVIVALVVWAVR |
| Ga0187788_100235465 | 3300018032 | Tropical Peatland | VGFNAMQPGKIKRADLIMLVAAAVVILALVVWAIR |
| Ga0184626_100583124 | 3300018053 | Groundwater Sediment | MGFNAMRPGKVKTADLVMLVAAIVVVVALVIWAVR |
| Ga0184616_103352272 | 3300018055 | Groundwater Sediment | MGFNAMQPGKVKRGDLLYLLAAVVVIAALIIWALA |
| Ga0187765_110578152 | 3300018060 | Tropical Peatland | MGFNAVQPGKIRKGDIIFFVLGLVVILALVIWAIR |
| Ga0184619_100063195 | 3300018061 | Groundwater Sediment | VGFNAMQPGKIKRGDLLYLLAAIVVVAGLLVWVAR |
| Ga0184618_104022152 | 3300018071 | Groundwater Sediment | VGFNAMQPGKIKKGDIAMLVAALVVIVALIVWATR |
| Ga0184624_100358574 | 3300018073 | Groundwater Sediment | VGFNAMQPGRIKRGDLWYLAAAIVAIGLLLAWAFFG |
| Ga0184640_1000025011 | 3300018074 | Groundwater Sediment | MGFNAMQPGKVKRGDILILVSAIVVIVALVVWAVR |
| Ga0184609_104874842 | 3300018076 | Groundwater Sediment | VGFNAMRPGKVKTADLVMFVAAIVVIVALVIWAIR |
| Ga0184627_105835512 | 3300018079 | Groundwater Sediment | VGFNAMRPGKTKGADLLYLLAAFVVISALIWWAVS |
| Ga0187774_112677471 | 3300018089 | Tropical Peatland | VGFNAMQPGKIKRWDLLYLLAAIVVIGGLILWAVR |
| Ga0190265_101485454 | 3300018422 | Soil | VGFNTMRPGKVKRADLLYLLAAIVVMVALVVWAVR |
| Ga0066655_100115562 | 3300018431 | Grasslands Soil | MGFNAMQPGKVKPGDLLFLIVALIVIGALLAWAFFGS |
| Ga0066667_104257871 | 3300018433 | Grasslands Soil | MGFNAMQPGRVKRGDLVFLIVAVIVIGALVAWAFFGS |
| Ga0066667_105398332 | 3300018433 | Grasslands Soil | MGFNAMQPGKVKRGDLLFLIVALIVIGALLAWAFFGS |
| Ga0190269_118853111 | 3300018465 | Soil | VGFNYQQPGKIKRGDWIMLIAAVVVVAALVIWAVR |
| Ga0190268_100344682 | 3300018466 | Soil | MGFNYQQPGKIKRGDWIMLVAAIVIVAGLVIWAVR |
| Ga0190268_100711592 | 3300018466 | Soil | MGFNAMQPGKIKRGDLLFLLAAIVIVGALVAWALFGS |
| Ga0190268_104554013 | 3300018466 | Soil | MGFNYQQPGKIKRGDWIMLVAAILVVGALVIWAVR |
| Ga0190268_120572381 | 3300018466 | Soil | MGFNAMQPGKIRRDDWIMLGAAVVIILALVIWAIR |
| Ga0190270_113499412 | 3300018469 | Soil | VGFNAMQPGKIKRGDLLFLLAAIVIVVALVVWALSA |
| Ga0190270_121492092 | 3300018469 | Soil | VGFNAMQPGKVKRGDLLFLLAAIVVVVALVVWALTA |
| Ga0190274_113327161 | 3300018476 | Soil | MGFNAMQPGKTKRADYIMLGAAFVVVLALVIWAIR |
| Ga0066669_102051302 | 3300018482 | Grasslands Soil | MGFNAMQPGKVKRGDLLFLIAAVIVIGLLVAWALFGS |
| Ga0066669_104375201 | 3300018482 | Grasslands Soil | MGFNAMRPGKVKRGDLLMLLAAVVIVAGLVFWAVH |
| Ga0066669_108685703 | 3300018482 | Grasslands Soil | MGFNAMQPGKVKRGDLLFLIVALIVIGALVAWAFFGS |
| Ga0066669_112145692 | 3300018482 | Grasslands Soil | MGFNAMQPGKIRKGDIIFFVSGLAVILALVIWAIR |
| Ga0173481_100188373 | 3300019356 | Soil | MGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGL |
| Ga0173481_105076702 | 3300019356 | Soil | VGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWAFFGS |
| Ga0173481_107475492 | 3300019356 | Soil | VGFNAMQPGRIKRGDILYLVAAIVVIVALVVWAIR |
| Ga0173479_101720713 | 3300019362 | Soil | GFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG |
| Ga0173479_105607883 | 3300019362 | Soil | VGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFG |
| Ga0206227_11177342 | 3300021063 | Deep Subsurface Sediment | VGFNAMRPGKIKGADLVYLLAALVVIAGLIWWAVS |
| Ga0210381_102827653 | 3300021078 | Groundwater Sediment | MGFNAMQPGKIKKGDIIMLVAAIAVVLALIVWAVR |
| Ga0210380_101789092 | 3300021082 | Groundwater Sediment | MGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG |
| Ga0196959_100240293 | 3300021184 | Soil | MGFNAMQPGRIKRGDLVYLAAAIVVIVALVVWAVG |
| Ga0196959_101081292 | 3300021184 | Soil | VGFNAMQPGRIKRGDLLYLAAAIVVIVALVVWAVG |
| Ga0210351_13470611 | 3300021316 | Estuarine | MGFNAKQPGKIKRADIIMLGAFIVVTVALLLWALKG |
| Ga0210341_17165182 | 3300021337 | Estuarine | MGFNAKQPGKIKRADLIMLGAFIVVTVALLLWALKG |
| Ga0193694_10033322 | 3300021415 | Soil | VGFNAMQPGKVKRGDLLFLIAAVIVIGALLAWAFFGS |
| Ga0193695_10263391 | 3300021418 | Soil | MGFNAMQPGKVKRGDLLFLIAAVIVIGVLVAWAFFGS |
| Ga0224500_100864822 | 3300022213 | Sediment | MGFNAKQPGKIKRADLIMLGAFVVVAAALLLWALRG |
| Ga0212093_100137545 | 3300022554 | Hot Spring Sediment | MGFNAMRPGKVKRGDLLYLAAALIVMAALVIWAVR |
| Ga0222622_109076303 | 3300022756 | Groundwater Sediment | VGFNYQQPGKIKRGDWIMLIVAAVVVAGLVIWAVR |
| Ga0247789_10848941 | 3300023266 | Soil | MGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFG |
| Ga0247672_10695953 | 3300024187 | Soil | MGFNAMQPGKIKKGDLIFFISGLVVILGLVIWAIR |
| Ga0209619_101818773 | 3300025159 | Soil | VGFNAMQPGKVKRGDLLYLLAAVIVIGVLIAWALS |
| Ga0209619_104076533 | 3300025159 | Soil | MGFNAMQPGKIKRGDLLYLLSAIVVVVGLIVWAVR |
| Ga0209109_103241422 | 3300025160 | Soil | VGFNAMRPGKIKRADLLYLLAALLVIVGLVVWAVW |
| Ga0209521_100459353 | 3300025164 | Soil | VGFNAMQPGKVKRGDLVYLLAAVIVIGVLIAWALS |
| Ga0209642_107810762 | 3300025167 | Soil | MGFNAMQPGRIKPADLLYLLAAVVVIGGLIWWAVS |
| Ga0209172_1000277330 | 3300025310 | Hot Spring Sediment | MGFNAMQPGKVKRGDLLYLLAALIVIVGLVVWAVR |
| Ga0209172_100089754 | 3300025310 | Hot Spring Sediment | VGFNAMQPGKIKRGDLLYLAAGILVIVALVLWAIL |
| Ga0209172_101299414 | 3300025310 | Hot Spring Sediment | MGFNAMQPGKVKRGDLLYLLAAVIVIVGMIVWAVR |
| Ga0209431_101375702 | 3300025313 | Soil | MGFNAMQPGKIKRGDVLFLVAAALVIGALLAWAFFGS |
| Ga0209641_103142393 | 3300025322 | Soil | MGFNAMQPGKIKPADLLYLLAAIVVIGGLIWWAVS |
| Ga0209641_108276291 | 3300025322 | Soil | MGFNAMQPGKLKPADLLYLTAAIVVIAALIWWAVS |
| Ga0209751_108871143 | 3300025327 | Soil | MGFNAMQPGKIKKSDLLYLAAAVVIILGLVIWAVA |
| Ga0210083_10049735 | 3300025521 | Natural And Restored Wetlands | SEGDTVGFNAMQPGKIKKGDVVMLIAAVVVVLALVIWAVR |
| Ga0210061_10040624 | 3300025537 | Natural And Restored Wetlands | MGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAVR |
| Ga0210094_10136444 | 3300025549 | Natural And Restored Wetlands | MGFNAMQPGKIKPADLLYLLAAVVVIAGLIWWAAS |
| Ga0207653_101869562 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGS |
| Ga0207642_100284253 | 3300025899 | Miscanthus Rhizosphere | VGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWALFGS |
| Ga0207642_100332314 | 3300025899 | Miscanthus Rhizosphere | MGFNAMQPGKVKRADLLFLIAAMIVVGALLAWAFFGS |
| Ga0207684_102316424 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFNAMQPGKVKRGDLLYLVVALIVIGLLVAWAFFGT |
| Ga0207652_117614443 | 3300025921 | Corn Rhizosphere | VGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG |
| Ga0207646_108553811 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFNAMQPGKVKRGDLLYLVVALIVIGLLLAWAFFGT |
| Ga0207646_108971353 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFNYQQPGKIKRADWIMLIVAAVAIAGLIVWAAR |
| Ga0207690_107464403 | 3300025932 | Corn Rhizosphere | VTVGFNAMQPGRIKRGDLWYLVAAIVVIGALVIWAVR |
| Ga0207686_100862183 | 3300025934 | Miscanthus Rhizosphere | MGFNAMQPGKVKRADLIMLICAIVVVGALIFWAVH |
| Ga0207670_102401592 | 3300025936 | Switchgrass Rhizosphere | VGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVH |
| Ga0207669_119514242 | 3300025937 | Miscanthus Rhizosphere | SPSSGRTSSRRGNDVGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFG |
| Ga0207665_100873335 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL |
| Ga0207679_102899403 | 3300025945 | Corn Rhizosphere | VGFNAMQPGRIKRGDLWYLVAAIVVIGALVIWAVR |
| Ga0207651_107754873 | 3300025960 | Switchgrass Rhizosphere | VGFNYQQPGKIKRGDWIMLIAAVVVVVGLVIWAVR |
| Ga0210102_11392412 | 3300025971 | Natural And Restored Wetlands | VGFNAMQPGKIKGADLLYLLAAVVVIAGLIWWAVS |
| Ga0208415_10092933 | 3300025993 | Rice Paddy Soil | MGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAAR |
| Ga0207677_118020852 | 3300026023 | Miscanthus Rhizosphere | MGFNAMRPGKIKRGDVIFLIAAIVVIGALLAWAFFGS |
| Ga0207708_107746603 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | HVGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWALFGS |
| Ga0207702_113454793 | 3300026078 | Corn Rhizosphere | MGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGS |
| Ga0207648_116713402 | 3300026089 | Miscanthus Rhizosphere | VGFNAMQPGKIKRGDLVLLIAAIVVIGALLAWAFFG |
| Ga0207676_109106553 | 3300026095 | Switchgrass Rhizosphere | IVGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVR |
| Ga0207683_103300911 | 3300026121 | Miscanthus Rhizosphere | GSEGDGVGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVR |
| Ga0256821_10205623 | 3300026452 | Sediment | VGFNAMQPGRIKRGDLLFLIAGIVVIGALLAWALFG |
| Ga0209058_12635792 | 3300026536 | Soil | MGFNAMQPGRVKRGDLVYLIVALIVIGLLLAWAFFGT |
| Ga0209805_11160563 | 3300026542 | Soil | MGFNAMQPGRVKRGDLVFLIVAVVVIGALVAWAFFGS |
| Ga0209474_103033342 | 3300026550 | Soil | LGFNAMRPGRVKGADLLMLLAAIVIVGALVFWAVR |
| Ga0209577_104767963 | 3300026552 | Soil | MGFNAMRPGRVKGADLLMLLAAIVIVGALVFWAVR |
| Ga0207454_1026082 | 3300026746 | Soil | VGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWAFLGS |
| Ga0207587_1023462 | 3300026747 | Soil | MGFNAMQPGKVKRGDLLFLIAAVIVVGALLAWAFFGS |
| Ga0209884_10280101 | 3300027013 | Groundwater Sand | EAEVGFNAMRPGKVKAADLVMLVAAIVVIVALVIWAIR |
| Ga0209877_10165243 | 3300027032 | Groundwater Sand | MGFNAMQPGKVKRADILMLVSAIVVIVALVVWAVR |
| Ga0209387_10988034 | 3300027639 | Agricultural Soil | VGFNTMRPGKVKRGDLLYLIAAIVVIAALVIWAVR |
| Ga0214468_10353034 | 3300027647 | Soil | VGFNTMRPGKVKRGDLLYLVAAIVVMVALVVWAVR |
| Ga0209286_10353575 | 3300027713 | Freshwater Sediment | VGFNAMQPGKVKRGDLVYLIAAIVVIGALVAWALS |
| Ga0209689_13759613 | 3300027748 | Soil | MGFNAMRPGRVRRGDLIMLLAAIVIVAALVYWAVH |
| (restricted) Ga0233416_100127445 | 3300027799 | Sediment | VGFNAMQPGKIKRADLLYLLAAIVVIGGLIVWAIR |
| (restricted) Ga0233416_100221882 | 3300027799 | Sediment | VGFNAMQPGKIKRGDLLYLLAAVIVIVALVVWAVS |
| Ga0209706_100455221 | 3300027818 | Freshwater Sediment | VGFNAMQPGKVKRGDLLYLLAAIVVIVGLVVWAVR |
| Ga0209023_100764025 | 3300027870 | Freshwater And Sediment | VGFNAMQPGKIKRGDLIMLVVAVVVVVALILWAIG |
| Ga0209590_102326591 | 3300027882 | Vadose Zone Soil | MGFNAMQPGKVKRGDLLLLIVALIVIGALVAWAFFGS |
| Ga0209590_104707662 | 3300027882 | Vadose Zone Soil | MGFNSMQPGKVKRGDLIMLAAALAVLVALVVWAVR |
| Ga0209069_101898582 | 3300027915 | Watersheds | VGFNAMQPGKIKKGDVIMLVAAVVVFAALIVWAVR |
| Ga0209705_101473993 | 3300027979 | Freshwater Sediment | VGFNAMQPGKVKRGDLVFLIAAIVVIGALVAWALS |
| Ga0268265_123173012 | 3300028380 | Switchgrass Rhizosphere | MGFNAMQPGRIKRGDVIFLIAAIVVIGALLAWAFFGL |
| Ga0247818_111409002 | 3300028589 | Soil | MGFNAMQPGKVKRGDLLVLIAAVIVIGALLAWAFFGS |
| Ga0307285_101449931 | 3300028712 | Soil | RAMGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG |
| Ga0307298_100664774 | 3300028717 | Soil | VGFNYQQPGKIKRGDWIMLIVAVVVVAGLVIWAVR |
| Ga0307318_100770024 | 3300028744 | Soil | MGFNAMQPGKIKRGDLLFLAGAIVIVGALVAWALFGS |
| Ga0307318_102426043 | 3300028744 | Soil | MGFNYRQPGSIKRGDWIMLIAAAVILAALVIWAVR |
| Ga0307320_102114133 | 3300028771 | Soil | VGFNAMQPGKIKRGDLLLLLAAIVVVGALLAWAFFGS |
| Ga0307306_100292672 | 3300028782 | Soil | VGFNAMQPGKVKRGDLIFLIAAVVVIGALLAWAFFG |
| Ga0307282_100798484 | 3300028784 | Soil | VGFNAMQPGKIKKGDIVMLVAALVVIVALLVWATR |
| Ga0307282_106077241 | 3300028784 | Soil | MGFNAMQPGKVKRGDLLFLFAAVIVIGVLVAWAFFGS |
| Ga0307299_103930842 | 3300028793 | Soil | VGFNAMQPGKIKRGDVIMLAAAVVVIVGLVVWAIR |
| Ga0307503_101675492 | 3300028802 | Soil | MGFNAMQPGKIKRGDLLYLLAAVIVIGALLLWAFLG |
| Ga0307503_101885212 | 3300028802 | Soil | MGFNAMQPGKIKRGDLWFLLAAVIVIGALLLWAFFG |
| Ga0307503_103868203 | 3300028802 | Soil | MGFNAMQPGKIKKGDIVMLVAAIVIVLALVVWAVR |
| Ga0307503_104969711 | 3300028802 | Soil | PARSAATTGSEGDGVGFNAMQPGKIKRGDIIMLVAAIIIVLALVIWAVR |
| Ga0307503_105119003 | 3300028802 | Soil | VGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVR |
| Ga0307503_107326662 | 3300028802 | Soil | MGFNYQQPGKIKRGDWIMLIAAIVVLAALVIWAVR |
| Ga0307281_102928343 | 3300028803 | Soil | VGFNAMQPGKIKKGDIVMLVAAVVVVLALIVWAAH |
| Ga0307305_104787562 | 3300028807 | Soil | MGFNAMQPGKVKKGDLVMLGAAIIVAIALVVWIIR |
| Ga0307302_102649283 | 3300028814 | Soil | VGFNAMQPGRIKKGDIVMLVAAIVVIVALIVWATR |
| Ga0307296_102999382 | 3300028819 | Soil | VGFNAMQPGKIKRGDVIMLVAAVVVIVGLVVWAIR |
| Ga0307310_100649882 | 3300028824 | Soil | MGFNYQQPGKIKRADWIMLIAAAVVIAGLIVWATR |
| Ga0307286_102108563 | 3300028876 | Soil | MGFNAMQPGKIKKGDIVMLIAAVVVVLALVIWAVR |
| Ga0307286_103975501 | 3300028876 | Soil | VGFNAMQPGRIKRGDLWYLLAAIVAIGLLLAWAFFG |
| Ga0307300_101793882 | 3300028880 | Soil | MGFNAMQPGKIKRGDLIFLIAAIVVVGALLAWACFGL |
| Ga0307277_104311362 | 3300028881 | Soil | MGFNAMQPGKVKRGDLVYLIAAVIVIGALLAWAFFGS |
| Ga0272449_10397904 | 3300029977 | Sediment | MGFNAMRPGKVKRGDLLYLAAALVVMAALVIWAVR |
| Ga0299907_1000001650 | 3300030006 | Soil | VGFNAMQPGKVKRADLLYLVAAIVVIVVLIVWATR |
| Ga0299907_100639942 | 3300030006 | Soil | VGFNAMQPGKIKRGDIVMLVSALALIAGALVWALR |
| Ga0299907_110412142 | 3300030006 | Soil | VGFNAMQPGKIKRGDILMLLAAIVVIVALVAWALQ |
| Ga0247826_101563744 | 3300030336 | Soil | MGFNAMQPGKVKRGDLLLLIAAVIVIGALLVWAFFGS |
| Ga0247826_104158823 | 3300030336 | Soil | MGFNAMQPGRIKRGDLWYLVAAIVAIGLLLAWAFFG |
| Ga0299915_101567682 | 3300030613 | Soil | MGFNAMRPGKVRKGDLLYLLAAVVVIGALIVWAMS |
| Ga0299915_104871432 | 3300030613 | Soil | MGFNAMQPGKVKKGDLLYLLAAIIVIGALIVWALS |
| Ga0268386_103399923 | 3300030619 | Soil | VGFNAMQPGKMKRADLLYLLAAVVVIVGLVVWAVS |
| Ga0302046_112612473 | 3300030620 | Soil | MGFNAMQPGKIKKSDLLYLAAAVVVIVGLVIWAVA |
| Ga0308197_101904503 | 3300031093 | Soil | VGFNAMQPGKVKRGDLLFLIAAVIVIGVLLAWAFFGS |
| Ga0307498_101270073 | 3300031170 | Soil | PRLRVRMGFNAMQPGKFKKGDIVMLVAAIVIVIALIVWAVR |
| Ga0307498_104803671 | 3300031170 | Soil | VGFNYQQPGKIKRGDWIMLIAAAVVVAGLVIWAVR |
| Ga0307495_101705121 | 3300031199 | Soil | MGFNAMQPGKIKRGDLLYLLAAVIVIGALLLWAFFG |
| Ga0307506_100414103 | 3300031366 | Soil | VGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFGS |
| Ga0307506_101186892 | 3300031366 | Soil | MGFNAMQPGKIKRGDVLFLLAAVIVIGALLAWAFLG |
| Ga0308194_101160703 | 3300031421 | Soil | MGFNAMQPGKVKRGDMLFLIAAVIVIGVLLAWAFFGS |
| Ga0307505_101446702 | 3300031455 | Soil | VGFNAMQPGKIKRGDIIMLVAAIVVVLALVIWAVR |
| Ga0307408_1012218872 | 3300031548 | Rhizosphere | VGFNAMQPGRIKRGDLLMLVAAIVIVGALVAWALFGS |
| Ga0247727_1000370525 | 3300031576 | Biofilm | MGFNAMQPGKVKKGDLVFLVVAIVVIGALLAWAVFG |
| Ga0247727_100278448 | 3300031576 | Biofilm | VGFNAKRPGRVKRADLLYLGAAIVVIGALLIWALAG |
| Ga0307469_109117453 | 3300031720 | Hardwood Forest Soil | MGFNAMQPGKVKRGDLLYLVVALIVIGLLLAWAFFGS |
| Ga0307469_120594581 | 3300031720 | Hardwood Forest Soil | MGFNAMQPGRIKRGDLLFLLAAIVVVGALLAWAFFGT |
| Ga0307468_1021538772 | 3300031740 | Hardwood Forest Soil | GLLPRLRVRMGFNAMQPGKIKKGDIVMLVAAIAIVVALIVWAVR |
| Ga0315290_101783133 | 3300031834 | Sediment | MGFNAMQPGKIKRGDLLFLLAALVVIGGLLAWAFFG |
| Ga0315297_103580133 | 3300031873 | Sediment | MGFNAMQPGKIKRGDLLFLLAAIVVIGGLLAWAFFG |
| Ga0310900_104068494 | 3300031908 | Soil | VGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVH |
| Ga0214473_100131576 | 3300031949 | Soil | VGFNAMQPGKIKRGDLLMLIAALVVIGALVAWAMFAS |
| Ga0214473_100895675 | 3300031949 | Soil | VGFNAMQPGRIKRGDMLFLIAAIVVIGALLAWALFG |
| Ga0214473_101024763 | 3300031949 | Soil | MGFNARQPGKVKRGDLLYLAAGLIVITALLIWALTG |
| Ga0214473_101034925 | 3300031949 | Soil | MGFNAMQPGKIKPADLLYLLAAIVVIGGLIWWAAS |
| Ga0214473_101756863 | 3300031949 | Soil | MGFNAMQPGKIKRADVLYLLAAVVVIGALIWWAVS |
| Ga0214473_101766225 | 3300031949 | Soil | VGFNAMRPGKIKGADLLYLLAALVVIAALIWWAVS |
| Ga0214473_105806153 | 3300031949 | Soil | MGFNAMRPGKVKKGDLLYLLAAVIVIGALIVWALS |
| Ga0214473_106162484 | 3300031949 | Soil | VGFNAMRPGKVRKGDLVFLGAAAVAIAALLLWAFWG |
| Ga0214473_106477394 | 3300031949 | Soil | VGFNAMQPGKVKRGDLLYLLAAVIVIGALIAWALS |
| Ga0214473_117088183 | 3300031949 | Soil | VGFNAMQPGKIKRADLLYLLAAVVVIGALIWWAVSL |
| Ga0214473_119574583 | 3300031949 | Soil | MGFNAMQPGKLKPADLLYLAAAIVVVAALIWWAVS |
| Ga0214473_121637091 | 3300031949 | Soil | MGFNAMQPGKVKRADILMLVSAIVVIVALVVWAIR |
| Ga0326597_101424602 | 3300031965 | Soil | MGFNAMQPGKIKKSDLLYLAAAVVVIVGLVIWAIA |
| Ga0326597_105568463 | 3300031965 | Soil | MGFNAMQPGKIKRADLLYLLAAVVVIGGLIWWAVS |
| Ga0326597_109047943 | 3300031965 | Soil | VGFNAMQPGKIKRGDLIMLVIAVAVVVALILWAVG |
| Ga0326597_115453212 | 3300031965 | Soil | VGFNAMRPGKVKTADLVMLVAAIVVIVALVIWATR |
| Ga0326597_120175611 | 3300031965 | Soil | DGLTMGFNAMQPGKIKRADVLYLLAAVVVIGALIWWAVS |
| Ga0307415_1006232081 | 3300032126 | Rhizosphere | GVGFNAMQPGRIKRGDLLMLVAAIVIVGALVAWALFGS |
| Ga0315281_103189133 | 3300032163 | Sediment | MGFNAMQPGKIKRGDLLFLVAALLVIAALVIWALAG |
| Ga0307470_112390752 | 3300032174 | Hardwood Forest Soil | MGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFGS |
| Ga0315276_103829095 | 3300032177 | Sediment | VGFNAMQPGKVRKGDLLYLVAAIVVIGALIAWAVH |
| Ga0315271_101368102 | 3300032256 | Sediment | VGFNYQQPGKIKKADWVMLISALVIVVALVVWAMS |
| Ga0315273_116555252 | 3300032516 | Sediment | VGFNAMQPGKTKRGDMLFLAAAVIVVGLLLAWAFFG |
| Ga0335085_1002070910 | 3300032770 | Soil | MGFNAMQPGRIKRSDLLFLVAAIVVVGVLLAWAFFGT |
| Ga0335084_101425036 | 3300033004 | Soil | VGFNAMQPGKIKRADLIMLAAAAVVIVALIVWAVR |
| Ga0335084_117691782 | 3300033004 | Soil | VGFNAMQPGRIKRGDLLYLLAAIVVIVGLLAWALR |
| Ga0334722_100875842 | 3300033233 | Sediment | MGFNAMQPGKIKKADIAMLVAAVVVIVALIAWAAH |
| Ga0334722_109607333 | 3300033233 | Sediment | VGFNAMQPGRIKGADLLYLLAAVVVIGALLWWATS |
| Ga0214472_101836574 | 3300033407 | Soil | VGFNTMRPGKVKRGDLLYLAAAIVVLAALVIWAVR |
| Ga0316622_1007194654 | 3300033416 | Soil | VTVGFNAMRPGKVRRGDLLYLLAAAVVIGGLIIWAAR |
| Ga0326726_100436273 | 3300033433 | Peat Soil | MGFNAMQPGRIKRADLLYLVAAVVVIGALLAWAFFGR |
| Ga0326726_102249174 | 3300033433 | Peat Soil | MGFNAMQPGKIKKGDIVMLVAAIVIVAALIVWAVR |
| Ga0316626_106322164 | 3300033485 | Soil | WSGSPDRRRRPVGFNAMQPGKIKKGDLVFLVAAIVVTGALLAWALFG |
| Ga0299912_103254812 | 3300033489 | Soil | MGFNAMRPGKVRKGDLLYLLAAVVVIGVLIVWALS |
| Ga0316616_1025922762 | 3300033521 | Soil | MTMGFNAMQPGKIKKGDLLYLLAAVVVIGGLIVWAVR |
| Ga0247830_116081203 | 3300033551 | Soil | VGFNAMQPGKIKKGDIVMLVAAVVVVLALVIWAVR |
| Ga0373902_083683_329_436 | 3300034099 | Sediment Slurry | VGFNAMQPGKIKRGDLLYLIAAIVVIGALLVWAIR |
| Ga0370498_002791_2857_2964 | 3300034155 | Untreated Peat Soil | VGFNAMQPGKVKKGDLIMLGAAVVVIVLLILWVAL |
| Ga0364931_0182529_242_349 | 3300034176 | Sediment | VGFNAMRPGKTKGADLLYLLAAFVVISALIWWAAS |
| Ga0364932_0374826_70_177 | 3300034177 | Sediment | MGFNAMRPGKVKTADLVMLMAAIVVVVALVIWAIR |
| ⦗Top⦘ |