| Basic Information | |
|---|---|
| Family ID | F003565 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 479 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| Number of Associated Samples | 333 |
| Number of Associated Scaffolds | 479 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 14.32 % |
| % of genes near scaffold ends (potentially truncated) | 95.20 % |
| % of genes from short scaffolds (< 2000 bps) | 81.84 % |
| Associated GOLD sequencing projects | 312 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.033 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.392 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.522 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 479 Family Scaffolds |
|---|---|---|
| PF08388 | GIIM | 20.46 |
| PF00078 | RVT_1 | 7.31 |
| PF04392 | ABC_sub_bind | 5.64 |
| PF03401 | TctC | 1.04 |
| PF13420 | Acetyltransf_4 | 0.84 |
| PF00072 | Response_reg | 0.63 |
| PF04191 | PEMT | 0.42 |
| PF03466 | LysR_substrate | 0.42 |
| PF01699 | Na_Ca_ex | 0.42 |
| PF12833 | HTH_18 | 0.42 |
| PF07883 | Cupin_2 | 0.42 |
| PF00872 | Transposase_mut | 0.42 |
| PF13432 | TPR_16 | 0.42 |
| PF13704 | Glyco_tranf_2_4 | 0.42 |
| PF02652 | Lactate_perm | 0.42 |
| PF03972 | MmgE_PrpD | 0.42 |
| PF14281 | PDDEXK_4 | 0.42 |
| PF02518 | HATPase_c | 0.42 |
| PF02371 | Transposase_20 | 0.42 |
| PF13561 | adh_short_C2 | 0.42 |
| PF00496 | SBP_bac_5 | 0.21 |
| PF13408 | Zn_ribbon_recom | 0.21 |
| PF13185 | GAF_2 | 0.21 |
| PF00176 | SNF2-rel_dom | 0.21 |
| PF00884 | Sulfatase | 0.21 |
| PF13557 | Phenol_MetA_deg | 0.21 |
| PF01070 | FMN_dh | 0.21 |
| PF07690 | MFS_1 | 0.21 |
| PF01988 | VIT1 | 0.21 |
| PF00239 | Resolvase | 0.21 |
| PF05209 | MinC_N | 0.21 |
| PF12728 | HTH_17 | 0.21 |
| PF00486 | Trans_reg_C | 0.21 |
| PF01047 | MarR | 0.21 |
| PF16363 | GDP_Man_Dehyd | 0.21 |
| PF03083 | MtN3_slv | 0.21 |
| PF05598 | DUF772 | 0.21 |
| PF06742 | DUF1214 | 0.21 |
| PF01042 | Ribonuc_L-PSP | 0.21 |
| PF03781 | FGE-sulfatase | 0.21 |
| PF13180 | PDZ_2 | 0.21 |
| PF13701 | DDE_Tnp_1_4 | 0.21 |
| PF01609 | DDE_Tnp_1 | 0.21 |
| PF09722 | Xre_MbcA_ParS_C | 0.21 |
| PF03098 | An_peroxidase | 0.21 |
| PF00248 | Aldo_ket_red | 0.21 |
| PF11159 | DUF2939 | 0.21 |
| PF00296 | Bac_luciferase | 0.21 |
| PF13751 | DDE_Tnp_1_6 | 0.21 |
| PF00571 | CBS | 0.21 |
| PF00582 | Usp | 0.21 |
| PF00579 | tRNA-synt_1b | 0.21 |
| PF13610 | DDE_Tnp_IS240 | 0.21 |
| PF04188 | Mannosyl_trans2 | 0.21 |
| PF01494 | FAD_binding_3 | 0.21 |
| PF02668 | TauD | 0.21 |
| PF13502 | AsmA_2 | 0.21 |
| PF01548 | DEDD_Tnp_IS110 | 0.21 |
| PF00857 | Isochorismatase | 0.21 |
| PF01527 | HTH_Tnp_1 | 0.21 |
| PF01370 | Epimerase | 0.21 |
| PF13411 | MerR_1 | 0.21 |
| PF01152 | Bac_globin | 0.21 |
| PF13426 | PAS_9 | 0.21 |
| PF00440 | TetR_N | 0.21 |
| PF03050 | DDE_Tnp_IS66 | 0.21 |
| PF03534 | SpvB | 0.21 |
| PF01048 | PNP_UDP_1 | 0.21 |
| PF10048 | DUF2282 | 0.21 |
| PF10108 | DNA_pol_B_exo2 | 0.21 |
| PF13936 | HTH_38 | 0.21 |
| PF02810 | SEC-C | 0.21 |
| PF13505 | OMP_b-brl | 0.21 |
| PF13924 | Lipocalin_5 | 0.21 |
| PF00924 | MS_channel | 0.21 |
| PF13191 | AAA_16 | 0.21 |
| PF09694 | Gcw_chp | 0.21 |
| PF06186 | DUF992 | 0.21 |
| COG ID | Name | Functional Category | % Frequency in 479 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.64 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.04 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.63 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.42 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.42 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.42 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.42 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.42 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.42 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.21 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.21 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.21 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.21 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.21 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.21 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.21 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.21 |
| COG4095 | Sugar transporter, SemiSWEET family, contains PQ motif | Carbohydrate transport and metabolism [G] | 0.21 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.21 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.21 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.21 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.21 |
| COG5542 | Mannosyltransferase related to Gpi18 | Carbohydrate transport and metabolism [G] | 0.21 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.21 |
| COG0850 | Septum site-determining protein MinC | Cell cycle control, cell division, chromosome partitioning [D] | 0.21 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.21 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.21 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.21 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.21 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.21 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.21 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.21 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.21 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.21 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.21 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.21 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.21 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.21 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.21 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.21 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.21 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.21 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.45 % |
| Unclassified | root | N/A | 3.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01CDCUY | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 512 | Open in IMG/M |
| 2067725002|GPICC_F5MS3JC01AFKQX | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 536 | Open in IMG/M |
| 2088090015|GPICI_9252237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1180 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig73097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 810 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig9372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2095 | Open in IMG/M |
| 2170459010|GIO7OMY02JNHS2 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 516 | Open in IMG/M |
| 2189573004|GZGWRS402HAAJO | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1004654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1880 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1025214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 760 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1008419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1976 | Open in IMG/M |
| 3300000681|JGI12370J11904_100496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 745 | Open in IMG/M |
| 3300000690|JGI12582J11924_101371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 690 | Open in IMG/M |
| 3300000705|JGI12455J11871_102386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 742 | Open in IMG/M |
| 3300000723|JGI12372J11909_103636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 735 | Open in IMG/M |
| 3300000731|JGI12381J11899_1010112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 761 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10060565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 831 | Open in IMG/M |
| 3300001137|JGI12637J13337_1016441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 644 | Open in IMG/M |
| 3300001154|JGI12636J13339_1005874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1999 | Open in IMG/M |
| 3300001356|JGI12269J14319_10038394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3044 | Open in IMG/M |
| 3300001383|JGI20194J14741_1003585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2183 | Open in IMG/M |
| 3300001396|JGI20175J14863_1001783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis | 4050 | Open in IMG/M |
| 3300001397|JGI20177J14857_1031984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 597 | Open in IMG/M |
| 3300001407|JGI20192J14887_1013049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 777 | Open in IMG/M |
| 3300001407|JGI20192J14887_1014731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 693 | Open in IMG/M |
| 3300001412|JGI20173J14856_1008189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2105 | Open in IMG/M |
| 3300001593|JGI12635J15846_10460477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 756 | Open in IMG/M |
| 3300001593|JGI12635J15846_10583799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 651 | Open in IMG/M |
| 3300001625|JGI20248J16329_10002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3288 | Open in IMG/M |
| 3300001640|JGI20244J16305_100047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1974 | Open in IMG/M |
| 3300001641|JGI20238J16299_101958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 630 | Open in IMG/M |
| 3300001642|JGI20246J16307_100009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3605 | Open in IMG/M |
| 3300001648|JGI20242J16303_100330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1941 | Open in IMG/M |
| 3300001658|JGI20282J16327_101010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 525 | Open in IMG/M |
| 3300001686|C688J18823_10544381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 742 | Open in IMG/M |
| 3300002459|JGI24751J29686_10057394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 802 | Open in IMG/M |
| 3300002911|JGI25390J43892_10069221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 815 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10247486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 724 | Open in IMG/M |
| 3300004003|Ga0055445_10186670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 705 | Open in IMG/M |
| 3300005331|Ga0070670_100008733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8651 | Open in IMG/M |
| 3300005331|Ga0070670_100127828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2193 | Open in IMG/M |
| 3300005332|Ga0066388_101086497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1352 | Open in IMG/M |
| 3300005332|Ga0066388_102479009 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300005332|Ga0066388_103771097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300005340|Ga0070689_100093177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2377 | Open in IMG/M |
| 3300005340|Ga0070689_100104616 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300005367|Ga0070667_101980982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 548 | Open in IMG/M |
| 3300005435|Ga0070714_101195885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 741 | Open in IMG/M |
| 3300005436|Ga0070713_101215256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 730 | Open in IMG/M |
| 3300005456|Ga0070678_100064641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2712 | Open in IMG/M |
| 3300005548|Ga0070665_101185740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 774 | Open in IMG/M |
| 3300005553|Ga0066695_10369807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 895 | Open in IMG/M |
| 3300005586|Ga0066691_10485076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 739 | Open in IMG/M |
| 3300005586|Ga0066691_10623500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 641 | Open in IMG/M |
| 3300005713|Ga0066905_100212545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1456 | Open in IMG/M |
| 3300005713|Ga0066905_100359609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1166 | Open in IMG/M |
| 3300005713|Ga0066905_100802941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 816 | Open in IMG/M |
| 3300005713|Ga0066905_101165220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300005713|Ga0066905_101171454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 686 | Open in IMG/M |
| 3300005713|Ga0066905_101795528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 565 | Open in IMG/M |
| 3300005713|Ga0066905_102284441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300005764|Ga0066903_101768350 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300005764|Ga0066903_102302738 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300005764|Ga0066903_103282501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 874 | Open in IMG/M |
| 3300005764|Ga0066903_103499687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 846 | Open in IMG/M |
| 3300005764|Ga0066903_103791018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
| 3300005764|Ga0066903_106037090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 634 | Open in IMG/M |
| 3300005764|Ga0066903_107440825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 565 | Open in IMG/M |
| 3300005834|Ga0068851_10827134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 577 | Open in IMG/M |
| 3300005980|Ga0066798_10093414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 884 | Open in IMG/M |
| 3300006028|Ga0070717_10694540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 924 | Open in IMG/M |
| 3300006041|Ga0075023_100015125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2061 | Open in IMG/M |
| 3300006050|Ga0075028_100621168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 643 | Open in IMG/M |
| 3300006086|Ga0075019_10371026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 871 | Open in IMG/M |
| 3300006102|Ga0075015_100337353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 837 | Open in IMG/M |
| 3300006174|Ga0075014_100422144 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300006176|Ga0070765_101218796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae | 710 | Open in IMG/M |
| 3300006176|Ga0070765_101640205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 604 | Open in IMG/M |
| 3300006354|Ga0075021_10073772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1999 | Open in IMG/M |
| 3300006358|Ga0068871_100471697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1128 | Open in IMG/M |
| 3300006358|Ga0068871_101052048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 760 | Open in IMG/M |
| 3300006603|Ga0074064_11761787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 558 | Open in IMG/M |
| 3300006797|Ga0066659_10807490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 777 | Open in IMG/M |
| 3300006893|Ga0073928_10187865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1629 | Open in IMG/M |
| 3300006950|Ga0075524_10396535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 609 | Open in IMG/M |
| 3300009012|Ga0066710_101910488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 888 | Open in IMG/M |
| 3300009038|Ga0099829_10649987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 876 | Open in IMG/M |
| 3300009089|Ga0099828_10067524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 3017 | Open in IMG/M |
| 3300009137|Ga0066709_101697486 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300009143|Ga0099792_10147535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1293 | Open in IMG/M |
| 3300009176|Ga0105242_12824734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 536 | Open in IMG/M |
| 3300009177|Ga0105248_10402055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. | 1542 | Open in IMG/M |
| 3300009698|Ga0116216_10930700 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009789|Ga0126307_10111442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2174 | Open in IMG/M |
| 3300009824|Ga0116219_10054465 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300009824|Ga0116219_10139561 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300009839|Ga0116223_10540984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 675 | Open in IMG/M |
| 3300010037|Ga0126304_10174754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1398 | Open in IMG/M |
| 3300010041|Ga0126312_10807379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300010045|Ga0126311_10235672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
| 3300010047|Ga0126382_10442526 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300010047|Ga0126382_11158534 | Not Available | 689 | Open in IMG/M |
| 3300010101|Ga0127481_1127713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 608 | Open in IMG/M |
| 3300010147|Ga0126319_1279343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 811 | Open in IMG/M |
| 3300010154|Ga0127503_10277169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 678 | Open in IMG/M |
| 3300010341|Ga0074045_10213977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1286 | Open in IMG/M |
| 3300010360|Ga0126372_12344431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 584 | Open in IMG/M |
| 3300010362|Ga0126377_10136245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2289 | Open in IMG/M |
| 3300010362|Ga0126377_10301301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1581 | Open in IMG/M |
| 3300010366|Ga0126379_12513002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 614 | Open in IMG/M |
| 3300010366|Ga0126379_12966279 | Not Available | 568 | Open in IMG/M |
| 3300010366|Ga0126379_13164820 | Not Available | 551 | Open in IMG/M |
| 3300010366|Ga0126379_13807535 | Not Available | 505 | Open in IMG/M |
| 3300010379|Ga0136449_102930177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 669 | Open in IMG/M |
| 3300010396|Ga0134126_10480227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1435 | Open in IMG/M |
| 3300010397|Ga0134124_10572338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 1103 | Open in IMG/M |
| 3300010859|Ga0126352_1175854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
| 3300010868|Ga0124844_1063127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1343 | Open in IMG/M |
| 3300011270|Ga0137391_10501160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 1028 | Open in IMG/M |
| 3300012199|Ga0137383_11124975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 567 | Open in IMG/M |
| 3300012203|Ga0137399_10792675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 798 | Open in IMG/M |
| 3300012207|Ga0137381_10907761 | Not Available | 761 | Open in IMG/M |
| 3300012209|Ga0137379_10324506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1450 | Open in IMG/M |
| 3300012209|Ga0137379_10637244 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300012211|Ga0137377_11028388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300012355|Ga0137369_10370846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1040 | Open in IMG/M |
| 3300012358|Ga0137368_10458668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. JYMT SZCCT0428 | 827 | Open in IMG/M |
| 3300012358|Ga0137368_10659906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 661 | Open in IMG/M |
| 3300012360|Ga0137375_10509426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis rosea | 1022 | Open in IMG/M |
| 3300012363|Ga0137390_11919518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200 | 520 | Open in IMG/M |
| 3300012469|Ga0150984_108047682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 801 | Open in IMG/M |
| 3300012903|Ga0157289_10190777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 662 | Open in IMG/M |
| 3300012922|Ga0137394_10900375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 738 | Open in IMG/M |
| 3300012922|Ga0137394_11509301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 531 | Open in IMG/M |
| 3300012923|Ga0137359_11557373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 549 | Open in IMG/M |
| 3300012939|Ga0162650_100000601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3039 | Open in IMG/M |
| 3300012971|Ga0126369_11223368 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300013306|Ga0163162_10191707 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300014156|Ga0181518_10034604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3216 | Open in IMG/M |
| 3300014200|Ga0181526_10098656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1866 | Open in IMG/M |
| 3300014320|Ga0075342_1138427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 657 | Open in IMG/M |
| 3300014657|Ga0181522_10418884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 802 | Open in IMG/M |
| 3300015052|Ga0137411_1021263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 929 | Open in IMG/M |
| 3300015052|Ga0137411_1208607 | All Organisms → cellular organisms → Bacteria | 5224 | Open in IMG/M |
| 3300015242|Ga0137412_10681443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 768 | Open in IMG/M |
| 3300015245|Ga0137409_10030276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5253 | Open in IMG/M |
| 3300015372|Ga0132256_100137103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 2437 | Open in IMG/M |
| 3300015374|Ga0132255_100285907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2369 | Open in IMG/M |
| 3300016270|Ga0182036_10157886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1622 | Open in IMG/M |
| 3300016270|Ga0182036_10581928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 65-37 | 896 | Open in IMG/M |
| 3300016294|Ga0182041_11306347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300016294|Ga0182041_12016255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 537 | Open in IMG/M |
| 3300016319|Ga0182033_10995165 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300016357|Ga0182032_10984445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 720 | Open in IMG/M |
| 3300016371|Ga0182034_10125690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 1886 | Open in IMG/M |
| 3300016387|Ga0182040_10415803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
| 3300016387|Ga0182040_10691579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300016404|Ga0182037_10533065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 989 | Open in IMG/M |
| 3300016404|Ga0182037_11275295 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300016404|Ga0182037_12009325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300016422|Ga0182039_10805221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 834 | Open in IMG/M |
| 3300016422|Ga0182039_10931082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
| 3300016422|Ga0182039_11280523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300016422|Ga0182039_11337977 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300016422|Ga0182039_11472974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 619 | Open in IMG/M |
| 3300016422|Ga0182039_11589463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300016445|Ga0182038_10181038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1641 | Open in IMG/M |
| 3300016445|Ga0182038_10537713 | Not Available | 1002 | Open in IMG/M |
| 3300017822|Ga0187802_10001098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7120 | Open in IMG/M |
| 3300017822|Ga0187802_10053723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1475 | Open in IMG/M |
| 3300017822|Ga0187802_10228889 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300017822|Ga0187802_10334935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis | 593 | Open in IMG/M |
| 3300017925|Ga0187856_1166909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 818 | Open in IMG/M |
| 3300017926|Ga0187807_1021226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2004 | Open in IMG/M |
| 3300017927|Ga0187824_10069366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300017933|Ga0187801_10173526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300017933|Ga0187801_10442775 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300017946|Ga0187879_10013898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5055 | Open in IMG/M |
| 3300017955|Ga0187817_10067562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2220 | Open in IMG/M |
| 3300017955|Ga0187817_10707290 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300017972|Ga0187781_11472604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
| 3300017995|Ga0187816_10474437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 561 | Open in IMG/M |
| 3300017995|Ga0187816_10486908 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018006|Ga0187804_10594295 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300018021|Ga0187882_1321292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 591 | Open in IMG/M |
| 3300018023|Ga0187889_10167118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1031 | Open in IMG/M |
| 3300018027|Ga0184605_10528847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300018030|Ga0187869_10312609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 755 | Open in IMG/M |
| 3300018040|Ga0187862_10550779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 688 | Open in IMG/M |
| 3300018040|Ga0187862_10627291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 634 | Open in IMG/M |
| 3300018047|Ga0187859_10020457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3667 | Open in IMG/M |
| 3300018052|Ga0184638_1031858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1902 | Open in IMG/M |
| 3300018061|Ga0184619_10260671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 797 | Open in IMG/M |
| 3300018062|Ga0187784_10120386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2141 | Open in IMG/M |
| 3300018468|Ga0066662_11546299 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300018917|Ga0193611_1077891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 917 | Open in IMG/M |
| 3300018918|Ga0193616_1115950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 746 | Open in IMG/M |
| 3300019867|Ga0193704_1009380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1962 | Open in IMG/M |
| 3300019886|Ga0193727_1052408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1312 | Open in IMG/M |
| 3300019890|Ga0193728_1110438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1259 | Open in IMG/M |
| 3300019999|Ga0193718_1017148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1606 | Open in IMG/M |
| 3300020001|Ga0193731_1113585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 691 | Open in IMG/M |
| 3300020004|Ga0193755_1025369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1963 | Open in IMG/M |
| 3300020198|Ga0194120_10046087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3554 | Open in IMG/M |
| 3300020220|Ga0194119_10275723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1140 | Open in IMG/M |
| 3300020579|Ga0210407_10122091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1993 | Open in IMG/M |
| 3300020579|Ga0210407_10875855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 689 | Open in IMG/M |
| 3300020579|Ga0210407_11251745 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300020580|Ga0210403_10108007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2258 | Open in IMG/M |
| 3300020580|Ga0210403_10140430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1972 | Open in IMG/M |
| 3300020580|Ga0210403_10523749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
| 3300020581|Ga0210399_10040059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3753 | Open in IMG/M |
| 3300020581|Ga0210399_10367952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1200 | Open in IMG/M |
| 3300020582|Ga0210395_10116618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1980 | Open in IMG/M |
| 3300020583|Ga0210401_10184143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1944 | Open in IMG/M |
| 3300020583|Ga0210401_10303748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1456 | Open in IMG/M |
| 3300020583|Ga0210401_10597738 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300021073|Ga0210378_10036395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1958 | Open in IMG/M |
| 3300021078|Ga0210381_10010746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2213 | Open in IMG/M |
| 3300021080|Ga0210382_10031727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1989 | Open in IMG/M |
| 3300021082|Ga0210380_10129117 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300021088|Ga0210404_10049677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1967 | Open in IMG/M |
| 3300021168|Ga0210406_10136588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2064 | Open in IMG/M |
| 3300021168|Ga0210406_10147019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1980 | Open in IMG/M |
| 3300021168|Ga0210406_10535811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 922 | Open in IMG/M |
| 3300021170|Ga0210400_11045056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 663 | Open in IMG/M |
| 3300021171|Ga0210405_10439029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1026 | Open in IMG/M |
| 3300021178|Ga0210408_10129241 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300021178|Ga0210408_10209365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1551 | Open in IMG/M |
| 3300021178|Ga0210408_10718802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300021180|Ga0210396_10177886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1905 | Open in IMG/M |
| 3300021180|Ga0210396_10258127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1548 | Open in IMG/M |
| 3300021363|Ga0193699_10236187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 760 | Open in IMG/M |
| 3300021401|Ga0210393_10136198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1969 | Open in IMG/M |
| 3300021403|Ga0210397_10069314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 2306 | Open in IMG/M |
| 3300021403|Ga0210397_10789897 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300021404|Ga0210389_11263901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 566 | Open in IMG/M |
| 3300021405|Ga0210387_10543019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1033 | Open in IMG/M |
| 3300021405|Ga0210387_10984718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 739 | Open in IMG/M |
| 3300021407|Ga0210383_10148679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1989 | Open in IMG/M |
| 3300021420|Ga0210394_10124912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2228 | Open in IMG/M |
| 3300021432|Ga0210384_10166201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1981 | Open in IMG/M |
| 3300021432|Ga0210384_10167194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1975 | Open in IMG/M |
| 3300021475|Ga0210392_10757011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 724 | Open in IMG/M |
| 3300021478|Ga0210402_10175580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1961 | Open in IMG/M |
| 3300021479|Ga0210410_10434449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1175 | Open in IMG/M |
| 3300021479|Ga0210410_10545095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1033 | Open in IMG/M |
| 3300021559|Ga0210409_10777786 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300021559|Ga0210409_11414625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 571 | Open in IMG/M |
| 3300021559|Ga0210409_11453638 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021559|Ga0210409_11520514 | Not Available | 545 | Open in IMG/M |
| 3300021560|Ga0126371_10059178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3690 | Open in IMG/M |
| 3300021560|Ga0126371_10154984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2356 | Open in IMG/M |
| 3300022510|Ga0242652_1000781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 2029 | Open in IMG/M |
| 3300022530|Ga0242658_1233076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 514 | Open in IMG/M |
| 3300022534|Ga0224452_1019802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1864 | Open in IMG/M |
| 3300022889|Ga0247785_1016269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 801 | Open in IMG/M |
| 3300024227|Ga0228598_1007903 | Not Available | 2156 | Open in IMG/M |
| 3300025320|Ga0209171_10184439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1191 | Open in IMG/M |
| 3300025320|Ga0209171_10372760 | Not Available | 739 | Open in IMG/M |
| 3300025604|Ga0207930_1017964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2019 | Open in IMG/M |
| 3300025899|Ga0207642_10501268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 743 | Open in IMG/M |
| 3300025906|Ga0207699_11460872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300025910|Ga0207684_10197866 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1733 | Open in IMG/M |
| 3300025913|Ga0207695_11097185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 676 | Open in IMG/M |
| 3300025922|Ga0207646_10482013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1118 | Open in IMG/M |
| 3300025923|Ga0207681_10527606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 969 | Open in IMG/M |
| 3300025935|Ga0207709_10095485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1954 | Open in IMG/M |
| 3300025936|Ga0207670_10054932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2689 | Open in IMG/M |
| 3300025939|Ga0207665_10882331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300025981|Ga0207640_11271419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 656 | Open in IMG/M |
| 3300026023|Ga0207677_10035577 | All Organisms → cellular organisms → Bacteria | 3236 | Open in IMG/M |
| 3300026078|Ga0207702_10149824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2121 | Open in IMG/M |
| 3300026223|Ga0209840_1012567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1932 | Open in IMG/M |
| 3300026361|Ga0257176_1001903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1966 | Open in IMG/M |
| 3300026361|Ga0257176_1056580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 623 | Open in IMG/M |
| 3300026886|Ga0207982_1000414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2120 | Open in IMG/M |
| 3300027003|Ga0207722_1000901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3922 | Open in IMG/M |
| 3300027070|Ga0208365_1002722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2023 | Open in IMG/M |
| 3300027073|Ga0208366_1001937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1769 | Open in IMG/M |
| 3300027383|Ga0209213_1008836 | Not Available | 1805 | Open in IMG/M |
| 3300027480|Ga0208993_1054727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 722 | Open in IMG/M |
| 3300027546|Ga0208984_1084795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300027625|Ga0208044_1138045 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300027635|Ga0209625_1049414 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 939 | Open in IMG/M |
| 3300027651|Ga0209217_1002574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 5986 | Open in IMG/M |
| 3300027696|Ga0208696_1099692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 966 | Open in IMG/M |
| 3300027812|Ga0209656_10128229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1298 | Open in IMG/M |
| 3300027824|Ga0209040_10288884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300027846|Ga0209180_10405887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 772 | Open in IMG/M |
| 3300027846|Ga0209180_10531684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 656 | Open in IMG/M |
| 3300027846|Ga0209180_10775852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300027879|Ga0209169_10168123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1144 | Open in IMG/M |
| 3300027882|Ga0209590_10911959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 553 | Open in IMG/M |
| 3300027898|Ga0209067_10393842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 775 | Open in IMG/M |
| 3300027910|Ga0209583_10024083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1961 | Open in IMG/M |
| 3300028047|Ga0209526_10105032 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300028047|Ga0209526_10421103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium campsiandrae | 883 | Open in IMG/M |
| 3300028047|Ga0209526_10506910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 786 | Open in IMG/M |
| 3300028379|Ga0268266_10912401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 849 | Open in IMG/M |
| 3300028379|Ga0268266_11085568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 774 | Open in IMG/M |
| 3300028704|Ga0307321_1040664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 865 | Open in IMG/M |
| 3300028710|Ga0307322_10010100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2075 | Open in IMG/M |
| 3300028714|Ga0307309_10007987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1833 | Open in IMG/M |
| 3300028778|Ga0307288_10070855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1231 | Open in IMG/M |
| 3300028786|Ga0307517_10653746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 511 | Open in IMG/M |
| 3300028791|Ga0307290_10025665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2073 | Open in IMG/M |
| 3300028792|Ga0307504_10012081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1978 | Open in IMG/M |
| 3300028799|Ga0307284_10024590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1965 | Open in IMG/M |
| 3300028802|Ga0307503_10302494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 803 | Open in IMG/M |
| 3300028819|Ga0307296_10060307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2009 | Open in IMG/M |
| 3300028824|Ga0307310_10023414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2440 | Open in IMG/M |
| 3300028875|Ga0307289_10178549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 873 | Open in IMG/M |
| 3300028875|Ga0307289_10225603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 770 | Open in IMG/M |
| 3300028875|Ga0307289_10429906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 543 | Open in IMG/M |
| 3300028878|Ga0307278_10048118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1932 | Open in IMG/M |
| 3300028880|Ga0307300_10003935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3750 | Open in IMG/M |
| 3300028885|Ga0307304_10027449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1977 | Open in IMG/M |
| 3300029907|Ga0311329_10165113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1736 | Open in IMG/M |
| 3300029910|Ga0311369_10154728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2203 | Open in IMG/M |
| 3300029910|Ga0311369_10665646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 859 | Open in IMG/M |
| 3300029943|Ga0311340_10192789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2064 | Open in IMG/M |
| 3300030007|Ga0311338_10116114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3280 | Open in IMG/M |
| 3300030520|Ga0311372_11931764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 696 | Open in IMG/M |
| 3300030743|Ga0265461_10077325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1477 | Open in IMG/M |
| 3300030844|Ga0075377_11761653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 504 | Open in IMG/M |
| 3300030943|Ga0311366_11100504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 686 | Open in IMG/M |
| 3300030969|Ga0075394_12020759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 618 | Open in IMG/M |
| 3300030988|Ga0308183_1038766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 909 | Open in IMG/M |
| 3300031095|Ga0308184_1027471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 646 | Open in IMG/M |
| 3300031100|Ga0308180_1021696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 629 | Open in IMG/M |
| 3300031184|Ga0307499_10068543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 910 | Open in IMG/M |
| 3300031198|Ga0307500_10218090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 576 | Open in IMG/M |
| 3300031241|Ga0265325_10053264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2075 | Open in IMG/M |
| 3300031250|Ga0265331_10146698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1072 | Open in IMG/M |
| 3300031474|Ga0170818_104815815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 901 | Open in IMG/M |
| 3300031525|Ga0302326_10127631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4450 | Open in IMG/M |
| 3300031545|Ga0318541_10055538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2044 | Open in IMG/M |
| 3300031549|Ga0318571_10142686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 821 | Open in IMG/M |
| 3300031549|Ga0318571_10143976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 818 | Open in IMG/M |
| 3300031549|Ga0318571_10253701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 647 | Open in IMG/M |
| 3300031561|Ga0318528_10059025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1955 | Open in IMG/M |
| 3300031561|Ga0318528_10368219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 771 | Open in IMG/M |
| 3300031564|Ga0318573_10205688 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300031572|Ga0318515_10666667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300031572|Ga0318515_10696961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 537 | Open in IMG/M |
| 3300031573|Ga0310915_10100205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1956 | Open in IMG/M |
| 3300031573|Ga0310915_10223666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1320 | Open in IMG/M |
| 3300031585|Ga0315534_1019872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3280 | Open in IMG/M |
| 3300031585|Ga0315534_1046651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1839 | Open in IMG/M |
| 3300031652|Ga0315553_10119385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1293 | Open in IMG/M |
| 3300031679|Ga0318561_10322199 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300031680|Ga0318574_10075308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1830 | Open in IMG/M |
| 3300031680|Ga0318574_10371591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 834 | Open in IMG/M |
| 3300031681|Ga0318572_10078222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1833 | Open in IMG/M |
| 3300031681|Ga0318572_10089362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1722 | Open in IMG/M |
| 3300031681|Ga0318572_10813275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 555 | Open in IMG/M |
| 3300031708|Ga0310686_108600357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 539 | Open in IMG/M |
| 3300031712|Ga0265342_10214510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1039 | Open in IMG/M |
| 3300031718|Ga0307474_10264282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1320 | Open in IMG/M |
| 3300031719|Ga0306917_10264756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1320 | Open in IMG/M |
| 3300031723|Ga0318493_10038474 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
| 3300031723|Ga0318493_10643817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 592 | Open in IMG/M |
| 3300031736|Ga0318501_10020905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2750 | Open in IMG/M |
| 3300031744|Ga0306918_10415205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1049 | Open in IMG/M |
| 3300031744|Ga0306918_10934023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300031747|Ga0318502_10659353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 631 | Open in IMG/M |
| 3300031748|Ga0318492_10555081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 611 | Open in IMG/M |
| 3300031753|Ga0307477_10615426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300031765|Ga0318554_10053846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2207 | Open in IMG/M |
| 3300031768|Ga0318509_10045377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 2219 | Open in IMG/M |
| 3300031768|Ga0318509_10390407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 778 | Open in IMG/M |
| 3300031771|Ga0318546_11002804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 587 | Open in IMG/M |
| 3300031777|Ga0318543_10399133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 616 | Open in IMG/M |
| 3300031778|Ga0318498_10052101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1818 | Open in IMG/M |
| 3300031779|Ga0318566_10291075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 808 | Open in IMG/M |
| 3300031780|Ga0318508_1053094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1075 | Open in IMG/M |
| 3300031780|Ga0318508_1111549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 764 | Open in IMG/M |
| 3300031781|Ga0318547_10232312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1108 | Open in IMG/M |
| 3300031793|Ga0318548_10095930 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300031794|Ga0318503_10013111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 2223 | Open in IMG/M |
| 3300031794|Ga0318503_10139203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 780 | Open in IMG/M |
| 3300031795|Ga0318557_10036373 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300031797|Ga0318550_10019483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2782 | Open in IMG/M |
| 3300031797|Ga0318550_10044280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1976 | Open in IMG/M |
| 3300031805|Ga0318497_10362576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 810 | Open in IMG/M |
| 3300031820|Ga0307473_10834688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
| 3300031821|Ga0318567_10658916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300031832|Ga0318499_10159342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 880 | Open in IMG/M |
| 3300031833|Ga0310917_10625630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 730 | Open in IMG/M |
| 3300031846|Ga0318512_10318266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300031846|Ga0318512_10339205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 750 | Open in IMG/M |
| 3300031879|Ga0306919_10026975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3567 | Open in IMG/M |
| 3300031879|Ga0306919_10109076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1961 | Open in IMG/M |
| 3300031879|Ga0306919_11361118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 536 | Open in IMG/M |
| 3300031880|Ga0318544_10027386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense | 1959 | Open in IMG/M |
| 3300031880|Ga0318544_10096728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1110 | Open in IMG/M |
| 3300031880|Ga0318544_10150727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 891 | Open in IMG/M |
| 3300031890|Ga0306925_10348325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 1591 | Open in IMG/M |
| 3300031890|Ga0306925_11292304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 725 | Open in IMG/M |
| 3300031890|Ga0306925_11806255 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031890|Ga0306925_11924845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 561 | Open in IMG/M |
| 3300031890|Ga0306925_12013805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 544 | Open in IMG/M |
| 3300031896|Ga0318551_10062017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1914 | Open in IMG/M |
| 3300031896|Ga0318551_10095019 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300031910|Ga0306923_10018391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7333 | Open in IMG/M |
| 3300031910|Ga0306923_10144283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2714 | Open in IMG/M |
| 3300031910|Ga0306923_10279429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1909 | Open in IMG/M |
| 3300031910|Ga0306923_10981554 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300031912|Ga0306921_11074623 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031941|Ga0310912_10121467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1946 | Open in IMG/M |
| 3300031942|Ga0310916_10095144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2383 | Open in IMG/M |
| 3300031942|Ga0310916_10144334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1958 | Open in IMG/M |
| 3300031942|Ga0310916_10715087 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031942|Ga0310916_10802547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 792 | Open in IMG/M |
| 3300031942|Ga0310916_11617657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 526 | Open in IMG/M |
| 3300031945|Ga0310913_10079323 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
| 3300031945|Ga0310913_10102594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1936 | Open in IMG/M |
| 3300031945|Ga0310913_10315726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1104 | Open in IMG/M |
| 3300031946|Ga0310910_10617185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 859 | Open in IMG/M |
| 3300031947|Ga0310909_11197105 | Not Available | 614 | Open in IMG/M |
| 3300031954|Ga0306926_10499189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1495 | Open in IMG/M |
| 3300031954|Ga0306926_10858078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia calidae | 1090 | Open in IMG/M |
| 3300031954|Ga0306926_10869837 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300031954|Ga0306926_11204640 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300031962|Ga0307479_10192564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2007 | Open in IMG/M |
| 3300031962|Ga0307479_10924921 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031981|Ga0318531_10040125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1956 | Open in IMG/M |
| 3300031981|Ga0318531_10088375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1355 | Open in IMG/M |
| 3300032001|Ga0306922_10225297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2013 | Open in IMG/M |
| 3300032001|Ga0306922_11113606 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300032009|Ga0318563_10211567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 1046 | Open in IMG/M |
| 3300032009|Ga0318563_10401199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 742 | Open in IMG/M |
| 3300032012|Ga0310902_10197753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1177 | Open in IMG/M |
| 3300032025|Ga0318507_10289017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 712 | Open in IMG/M |
| 3300032035|Ga0310911_10064274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1944 | Open in IMG/M |
| 3300032039|Ga0318559_10291401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 757 | Open in IMG/M |
| 3300032041|Ga0318549_10234940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 824 | Open in IMG/M |
| 3300032041|Ga0318549_10348175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 667 | Open in IMG/M |
| 3300032044|Ga0318558_10024486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2485 | Open in IMG/M |
| 3300032044|Ga0318558_10352324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 730 | Open in IMG/M |
| 3300032044|Ga0318558_10372346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 709 | Open in IMG/M |
| 3300032051|Ga0318532_10179987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 750 | Open in IMG/M |
| 3300032051|Ga0318532_10314609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 555 | Open in IMG/M |
| 3300032052|Ga0318506_10034967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1952 | Open in IMG/M |
| 3300032052|Ga0318506_10180084 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300032052|Ga0318506_10357697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 648 | Open in IMG/M |
| 3300032054|Ga0318570_10148708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1047 | Open in IMG/M |
| 3300032055|Ga0318575_10614824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300032055|Ga0318575_10683164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 519 | Open in IMG/M |
| 3300032059|Ga0318533_10104108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1967 | Open in IMG/M |
| 3300032059|Ga0318533_10156666 | Not Available | 1614 | Open in IMG/M |
| 3300032059|Ga0318533_11173395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 562 | Open in IMG/M |
| 3300032064|Ga0318510_10226409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 762 | Open in IMG/M |
| 3300032066|Ga0318514_10033794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2414 | Open in IMG/M |
| 3300032076|Ga0306924_10051764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4535 | Open in IMG/M |
| 3300032076|Ga0306924_10252893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2023 | Open in IMG/M |
| 3300032076|Ga0306924_10345315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1707 | Open in IMG/M |
| 3300032076|Ga0306924_11235105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 806 | Open in IMG/M |
| 3300032076|Ga0306924_11725489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 655 | Open in IMG/M |
| 3300032080|Ga0326721_10042891 | All Organisms → Viruses → Predicted Viral | 1916 | Open in IMG/M |
| 3300032090|Ga0318518_10338196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 772 | Open in IMG/M |
| 3300032094|Ga0318540_10039019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2091 | Open in IMG/M |
| 3300032094|Ga0318540_10141517 | Not Available | 1150 | Open in IMG/M |
| 3300032160|Ga0311301_10204249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3377 | Open in IMG/M |
| 3300032160|Ga0311301_11523202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 821 | Open in IMG/M |
| 3300032205|Ga0307472_100100438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1988 | Open in IMG/M |
| 3300032205|Ga0307472_100553734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1004 | Open in IMG/M |
| 3300032205|Ga0307472_100964054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 795 | Open in IMG/M |
| 3300032261|Ga0306920_100400336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2041 | Open in IMG/M |
| 3300032261|Ga0306920_101141214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 1128 | Open in IMG/M |
| 3300032261|Ga0306920_101608556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 924 | Open in IMG/M |
| 3300032261|Ga0306920_102419934 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300032261|Ga0306920_103332427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300032955|Ga0335076_10080299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3202 | Open in IMG/M |
| 3300033550|Ga0247829_10801753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 784 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.01% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.04% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.63% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.63% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.42% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.42% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.21% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.21% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.21% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.21% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.21% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.21% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.21% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.21% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.21% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.21% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.21% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.21% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000681 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 | Environmental | Open in IMG/M |
| 3300000690 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 | Environmental | Open in IMG/M |
| 3300000705 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 | Environmental | Open in IMG/M |
| 3300000723 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 | Environmental | Open in IMG/M |
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001383 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 | Environmental | Open in IMG/M |
| 3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
| 3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
| 3300001407 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 | Environmental | Open in IMG/M |
| 3300001412 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001625 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 | Environmental | Open in IMG/M |
| 3300001640 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 | Environmental | Open in IMG/M |
| 3300001641 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 | Environmental | Open in IMG/M |
| 3300001642 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 | Environmental | Open in IMG/M |
| 3300001648 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 | Environmental | Open in IMG/M |
| 3300001658 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004003 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 | Environmental | Open in IMG/M |
| 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018917 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018918 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026886 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031100 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031585 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-40 | Environmental | Open in IMG/M |
| 3300031652 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_3805860 | 2040502001 | Soil | TVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| GPICC_01227960 | 2067725002 | Soil | LLLAVRPEGADHQWRKIPPGELSIDPVADERLVRATASAEAS |
| GPICI_02977460 | 2088090015 | Soil | RPEGADHQWRKIPPGELSIDPVADERLVRATASAEAS |
| A5_c1_01803670 | 2124908044 | Soil | NTSMMLARVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS |
| A5_c1_00573920 | 2124908044 | Soil | PEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| F62_00417280 | 2170459010 | Grass Soil | MSPEVAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAWVGAS |
| FG2_08125140 | 2189573004 | Grass Soil | LPKGFPRCRLLAVRPEGANHQWRKIPPGELSIDPVAKERLGWVTGRA |
| AP72_2010_repI_A10DRAFT_10046541 | 3300000651 | Forest Soil | LLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS* |
| AP72_2010_repI_A10DRAFT_10252141 | 3300000651 | Forest Soil | VMAVRPEGANHQWRKIPHGELSIDPVADERLVRVTAWVGAS* |
| AF_2010_repII_A100DRAFT_10084191 | 3300000655 | Forest Soil | ASMSGLPVRPEGANHQWRKIPSGKLSIGPVADERLGRATGRVGAX* |
| JGI12370J11904_1004961 | 3300000681 | Tropical Forest Soil | VMAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS* |
| JGI12582J11924_1013711 | 3300000690 | Tropical Forest Soil | VAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS* |
| JGI12455J11871_1023861 | 3300000705 | Tropical Forest Soil | MAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS* |
| JGI12372J11909_1036361 | 3300000723 | Tropical Forest Soil | LAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS* |
| JGI12381J11899_10101121 | 3300000731 | Tropical Forest Soil | CCNALGPEMAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS* |
| AF_2010_repII_A001DRAFT_100605652 | 3300000793 | Forest Soil | MSLVVAVRPEGAHHQWGRIPPGELSIDPVADERLVRATARVGAS* |
| JGI12637J13337_10164412 | 3300001137 | Forest Soil | LELAVRPEGAKHQWRRVPPRELSIDLVADERFGRVTGRAGAS* |
| JGI12636J13339_10058741 | 3300001154 | Forest Soil | LAVRPEGANHQWRRVPPRELSIDLVADERLGRVTGRAGAS* |
| JGI12269J14319_100383941 | 3300001356 | Peatlands Soil | AVRPEGANHLWRRVPPGELSIDPVADERLIWVTG* |
| JGI20194J14741_10035851 | 3300001383 | Arctic Peat Soil | PDGAYYQWRKIPPRELSIDLVADERLVWATERAEAS* |
| JGI20175J14863_10017831 | 3300001396 | Arctic Peat Soil | PSPTYSVRPDGAYYQWRKIPPRELSIDLVADERLVWATERAEAS* |
| JGI20177J14857_10319841 | 3300001397 | Arctic Peat Soil | SPDYSVRPDGAYYQRRKIPPRELSIDLVADERLVWATERAEAS* |
| JGI20192J14887_10130491 | 3300001407 | Arctic Peat Soil | YSVRPDGAYYQWRKIPPRELSIDLVADERLVWATERAEAS* |
| JGI20192J14887_10147312 | 3300001407 | Arctic Peat Soil | MQARVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS* |
| JGI20173J14856_10081892 | 3300001412 | Arctic Peat Soil | ASPTYSVRPDGAYYQWRKIPPRELSIDLVADERLVWATERAEAS* |
| JGI12635J15846_104604771 | 3300001593 | Forest Soil | LLAVRPEGANYQWRKIPPRELSIVLVADERLGRVTGWAGAS* |
| JGI12635J15846_105837992 | 3300001593 | Forest Soil | GLELAVRPEGAKHQWRRVPPRELSIDLVADERFGRVTGRAGAS* |
| JGI20248J16329_100021 | 3300001625 | Forest Soil | RPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS* |
| JGI20244J16305_1000473 | 3300001640 | Forest Soil | VAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS* |
| JGI20238J16299_1019581 | 3300001641 | Forest Soil | SLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS* |
| JGI20246J16307_1000094 | 3300001642 | Forest Soil | MAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS* |
| JGI20242J16303_1003301 | 3300001648 | Forest Soil | FVAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS* |
| JGI20282J16327_1010101 | 3300001658 | Forest Soil | VAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAWVGAS* |
| C688J18823_105443811 | 3300001686 | Soil | AVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS* |
| JGI24751J29686_100573941 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | SPTASMSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS* |
| JGI25390J43892_100692212 | 3300002911 | Grasslands Soil | LAVRPEGANHQWRKNPHGELSIDPVADERLVRVTARAGAS* |
| JGIcombinedJ51221_102474861 | 3300003505 | Forest Soil | LAVRPEGANYLWRKNPPRELSIDLVADERLGWVTGRAGAS* |
| Ga0055445_101866703 | 3300004003 | Natural And Restored Wetlands | AVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS* |
| Ga0065717_10112981 | 3300005276 | Arabidopsis Rhizosphere | LVLAVVPTASMSLLAVRPEGADHQWRKIPPGELSIDPEADEQLVRVTAWAEAS* |
| Ga0070670_1000087331 | 3300005331 | Switchgrass Rhizosphere | AVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS* |
| Ga0070670_1001278281 | 3300005331 | Switchgrass Rhizosphere | MSAIGMRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEA |
| Ga0066388_1010864973 | 3300005332 | Tropical Forest Soil | MSIECPLMAVRLEGANHLWRRNPPREMSISLVADKRFGRETGRAGAS* |
| Ga0066388_1024790091 | 3300005332 | Tropical Forest Soil | LAVRLEGANHQWRKIPPGELSINPEADERLGRVTGWAGAS* |
| Ga0066388_1037710972 | 3300005332 | Tropical Forest Soil | MAVRPEGAHHQWRRIPPGELSIDPVADERLVRATARVGAS |
| Ga0070689_1000931772 | 3300005340 | Switchgrass Rhizosphere | MSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS* |
| Ga0070689_1001046165 | 3300005340 | Switchgrass Rhizosphere | LLAVRPEGADYQWRKIPPGELSIDPEADERLGRVTGRAEAS* |
| Ga0070667_1019809822 | 3300005367 | Switchgrass Rhizosphere | AGFARSEIGFVSVRPEGVCHQRRRVPPRELSIDLVANERLGRATGRAEAS* |
| Ga0070714_1011958852 | 3300005435 | Agricultural Soil | LAVRPEGADHQWRKNPPGELSIDPVADERLVRATAWVGAS* |
| Ga0070713_1012152562 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVRPEGANHQWRKIPSRELSIELEADEQLGWATGRAGAS* |
| Ga0070678_1000646414 | 3300005456 | Miscanthus Rhizosphere | LAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS* |
| Ga0070665_1011857401 | 3300005548 | Switchgrass Rhizosphere | MSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAW |
| Ga0066695_103698071 | 3300005553 | Soil | AVRPEGADHQWRKIPPRELSIDLVADERLGWVTGRAEAS* |
| Ga0066691_104850762 | 3300005586 | Soil | FLAVRPEGANHQWRKNPPGELSIDPVADERLMRVTAWVGAS* |
| Ga0066691_106235001 | 3300005586 | Soil | AVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS* |
| Ga0066905_1002125453 | 3300005713 | Tropical Forest Soil | MAERPEGADYQWRKIPLGELSIDPVADERLVRVTARTGAS |
| Ga0066905_1003596091 | 3300005713 | Tropical Forest Soil | MSPEVAVRPEGADHQWRKNPPRELSIDLVADERLGRATGRLEPR |
| Ga0066905_1008029413 | 3300005713 | Tropical Forest Soil | LLRRICRLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0066905_1011652202 | 3300005713 | Tropical Forest Soil | MAVRPEGADYQWRKIPLGELSIDPVADERLVRATARAGAS |
| Ga0066905_1011714541 | 3300005713 | Tropical Forest Soil | AVRPEGANHQWRKNPPRELSIGLEADERLGRVTGRAGAS* |
| Ga0066905_1017955281 | 3300005713 | Tropical Forest Soil | AVRPEGANHQWRKNPPGELSIDPVADERLVRVTVRVGAS* |
| Ga0066905_1022844411 | 3300005713 | Tropical Forest Soil | MSPVLAERPEGADYQWRKIPLGELSIDPVADERLVRATARA |
| Ga0066903_1017683501 | 3300005764 | Tropical Forest Soil | VAVRPEGANHQWRKNPPGELSIDPVADERLMRVTAWVGAS* |
| Ga0066903_1023027383 | 3300005764 | Tropical Forest Soil | LKGIHSKECLLLVERPEGADYQWRKIPLGELSIDPVADERLVRATA |
| Ga0066903_1032825011 | 3300005764 | Tropical Forest Soil | VRPEGADHQWRKNPPRELSIDLVADERLGRATGRLEPR |
| Ga0066903_1034996871 | 3300005764 | Tropical Forest Soil | LAVRPEGANHQWRRNPPRELSIDLVADERLGRVTGRA |
| Ga0066903_1037910181 | 3300005764 | Tropical Forest Soil | VRPEGANHQWRRNPPGELSINPVADERLAWATARVGAS |
| Ga0066903_1060370901 | 3300005764 | Tropical Forest Soil | MAVRPEGANHQWRKNPPGELSINPVADERLVWATARVGAS |
| Ga0066903_1074408251 | 3300005764 | Tropical Forest Soil | MAVRPEGADHQWRKIPPGELSIDPEADERLSRVTGRAGAS |
| Ga0068851_108271341 | 3300005834 | Corn Rhizosphere | VRPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS* |
| Ga0066798_100934143 | 3300005980 | Soil | FVSVRPEGACHQRRRVPPRELSIDLVANERLGRVTGRAEAS* |
| Ga0070717_106945402 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RPEGADHQWRKNPPGELSIDPVADERLVRATAWVGAS* |
| Ga0075023_1000151252 | 3300006041 | Watersheds | AVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS* |
| Ga0075028_1006211681 | 3300006050 | Watersheds | VRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS* |
| Ga0075019_103710264 | 3300006086 | Watersheds | AVRPEGANHQWRKIPPRQLSIDLEADERLSRVTGRAGAS* |
| Ga0075015_1003373531 | 3300006102 | Watersheds | LMAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS* |
| Ga0075014_1004221441 | 3300006174 | Watersheds | VEEIGFVSVRPEGACHQRRRVPPRELSIDLVADERLGR |
| Ga0070765_1012187961 | 3300006176 | Soil | MLQRRSRVLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTG |
| Ga0070765_1016402052 | 3300006176 | Soil | LAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS* |
| Ga0075021_100737722 | 3300006354 | Watersheds | LLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS* |
| Ga0068871_1004716971 | 3300006358 | Miscanthus Rhizosphere | ARVRLEGACHLWRKIPSRELSIELEADEQLGWATGRAGAS* |
| Ga0068871_1010520482 | 3300006358 | Miscanthus Rhizosphere | ARVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS* |
| Ga0074064_117617871 | 3300006603 | Soil | VRPEGACHQWRKIPLRELSIDLVADERDGWATGRCEAS* |
| Ga0066659_108074902 | 3300006797 | Soil | RLMAVRPEGANHQWRKIPPRELSIDLEADGRFGRATGRAEAS* |
| Ga0073928_101878651 | 3300006893 | Iron-Sulfur Acid Spring | LAVRPEGANHLWRKIPPGELSIDPVADERLGWVTGR |
| Ga0075524_103965351 | 3300006950 | Arctic Peat Soil | EGACHLWRKIPFRQLSIDLEADERFGWVTGRAEAS* |
| Ga0066710_1019104881 | 3300009012 | Grasslands Soil | AVRPEGANHQWRKNPHGELSIDPVADERLVRVTARAGAS |
| Ga0099829_106499871 | 3300009038 | Vadose Zone Soil | LYFVRPEGVCHQWRKEPPGELSIDPVADERLGRVTGRAEAS* |
| Ga0099828_100675241 | 3300009089 | Vadose Zone Soil | MLLCMSLLVAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS* |
| Ga0066709_1016974861 | 3300009137 | Grasslands Soil | LAVRPEGANHQWRKIPPRELSIDLEADERFGRATGRAGAS* |
| Ga0099792_101475352 | 3300009143 | Vadose Zone Soil | MPVEVLSPECLLMAVRPEGANHQWRKIPPRELSIDLVADERLGRV |
| Ga0105242_128247341 | 3300009176 | Miscanthus Rhizosphere | GADHQWRKIPPGELSIDPVADERLVRATASAEAS* |
| Ga0105248_104020552 | 3300009177 | Switchgrass Rhizosphere | MSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVT |
| Ga0116216_109307002 | 3300009698 | Peatlands Soil | MHIECRLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGA |
| Ga0126307_101114424 | 3300009789 | Serpentine Soil | AVRLDGANYLWRKNPPRELSIDLVADERLVRVTGRAGAS* |
| Ga0116219_100544651 | 3300009824 | Peatlands Soil | GVRPEGAYHLWREVPPGELSIDPVADERLGWATGRVEAS* |
| Ga0116219_101395614 | 3300009824 | Peatlands Soil | VIGFVLVRPEGACHQRRRVPPRKLSIDLVADERLGRATGRAE |
| Ga0116223_105409841 | 3300009839 | Peatlands Soil | HRIAKICPVMAVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS* |
| Ga0126304_101747541 | 3300010037 | Serpentine Soil | GADHQWRKIPPGELSIDPVADERLGRVTGRAGAS* |
| Ga0126312_108073791 | 3300010041 | Serpentine Soil | MAVGPEGADHQWRKIPPGELSIDPVADERLGRATGRAGAS |
| Ga0126311_102356722 | 3300010045 | Serpentine Soil | VCPHTLRPVLTPDFPVRPDGAYHQWRKVPPRELSIDLVADERPGR |
| Ga0126382_104425261 | 3300010047 | Tropical Forest Soil | MAERPEGADYQWRKIPLGELSIDPVADERLVRATARA |
| Ga0126382_111585341 | 3300010047 | Tropical Forest Soil | MAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAG |
| Ga0127481_11277132 | 3300010101 | Grasslands Soil | RPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS* |
| Ga0126319_12793431 | 3300010147 | Soil | PEGANHQWRKIPPGELSIDPVADERLGRATARVGAS* |
| Ga0127503_102771691 | 3300010154 | Soil | PELAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAWVGAS* |
| Ga0074045_102139773 | 3300010341 | Bog Forest Soil | MFFVCSVRSEGAYHQWRKILPRELSIDLVADERSGWVTGR |
| Ga0126372_123444312 | 3300010360 | Tropical Forest Soil | PLMAVRLEGANHLWRRNPPREMSISLVADKRFGRETGRAGAS* |
| Ga0126377_101362454 | 3300010362 | Tropical Forest Soil | MAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTG |
| Ga0126377_103013011 | 3300010362 | Tropical Forest Soil | MLHCICRFLAVRPEGADHQWRKNPPRELSIDLVADERLGRATVGWP |
| Ga0126379_125130022 | 3300010366 | Tropical Forest Soil | VAVRPEGANHQWRKNPPGELSIDPVADERLVRATGWVGAS* |
| Ga0126379_129662793 | 3300010366 | Tropical Forest Soil | MAERPEGADYQWRKIPLGELSIDPVADERLVRVTA |
| Ga0126379_131648202 | 3300010366 | Tropical Forest Soil | VRPEGANHQWRRNPPGELSIDPVADERLVRVTAWAGAS* |
| Ga0126379_138075352 | 3300010366 | Tropical Forest Soil | LLRCMSPLLAVRPEGVNHLWRKKPRKELSIGLEADERLGRATGRAGAS* |
| Ga0136449_1029301771 | 3300010379 | Peatlands Soil | MAVRPEGANHLWRRVPPRELSIDLVADERLGRVTGRAGAS |
| Ga0134126_104802271 | 3300010396 | Terrestrial Soil | GANHQWRKIPPRELSIDLEADERLGRATGRAGAS* |
| Ga0134124_105723381 | 3300010397 | Terrestrial Soil | MAVRLEGANHQWRKIPSGELSIDPEADERLGWATGRVEAS* |
| Ga0126352_11758541 | 3300010859 | Boreal Forest Soil | EGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS* |
| Ga0124844_10631272 | 3300010868 | Tropical Forest Soil | AVRPDGANHQWRKNPPGELSIDPVADERLVRVTVRVGAS* |
| Ga0137391_105011602 | 3300011270 | Vadose Zone Soil | YFVRPEGVCHQWRKEPPGELSIDPVADERLGRVTGRAEAS* |
| Ga0137383_111249752 | 3300012199 | Vadose Zone Soil | AVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAEAS* |
| Ga0137399_107926751 | 3300012203 | Vadose Zone Soil | GADHQWRKIPPRELSIDLVADERFGRVTGRAGAS* |
| Ga0137381_109077612 | 3300012207 | Vadose Zone Soil | PEGADHQSRRIPAGELSIDPVADEWLGRVTGRAGAS* |
| Ga0137379_103245062 | 3300012209 | Vadose Zone Soil | EGADHQWRKIPPRELSIDLVADERLGRVTGRAEAS* |
| Ga0137379_106372443 | 3300012209 | Vadose Zone Soil | MECRLMAVRPEGADHQWRRIPPGELSIDPVADERLVRAT |
| Ga0137377_110283881 | 3300012211 | Vadose Zone Soil | LTIDYTREIGFVSVRPEGACHQRRRVPPRELSIDLVADERFGR |
| Ga0137369_103708463 | 3300012355 | Vadose Zone Soil | MSPELAVRPEGANHQWRKIPPGELSIDPVADEQLGRAT |
| Ga0137368_104586682 | 3300012358 | Vadose Zone Soil | VRCMSPELAVRPEGANHQWRKNPPRELSIDLVADERLVRVT |
| Ga0137368_106599061 | 3300012358 | Vadose Zone Soil | MSPLLAVRPEGANHQWRKIPPGELSIDPVADEQLGRATARAGA |
| Ga0137375_105094261 | 3300012360 | Vadose Zone Soil | VVAANIRAMSVMAVRPEGADHQWRKIPPRELSIDLVADERLGR |
| Ga0137390_119195181 | 3300012363 | Vadose Zone Soil | MSPVLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| Ga0150984_1080476821 | 3300012469 | Avena Fatua Rhizosphere | SRLCLFLAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS* |
| Ga0150984_1106304982 | 3300012469 | Avena Fatua Rhizosphere | VAAPAGVPASRLCLFLAVRPEGADHQWRKIPPRELSIDLVADERLGRVT |
| Ga0157289_101907771 | 3300012903 | Soil | VAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS* |
| Ga0137394_109003752 | 3300012922 | Vadose Zone Soil | MAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS* |
| Ga0137394_115093011 | 3300012922 | Vadose Zone Soil | RPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGAS* |
| Ga0137359_115573733 | 3300012923 | Vadose Zone Soil | MSELAVRPEGANHQWRKIPPRELSIDLVADERLGRVT |
| Ga0162650_1000006013 | 3300012939 | Soil | AVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS* |
| Ga0126369_112233681 | 3300012971 | Tropical Forest Soil | GAHHQWRRIPPGELSIDPIADERLVRATARVGAS* |
| Ga0163162_101917071 | 3300013306 | Switchgrass Rhizosphere | MAVRLEGANHQWRKVPSGELSIDPEADERLLRVTARAI |
| Ga0181518_100346043 | 3300014156 | Bog | MAVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS* |
| Ga0181526_100986562 | 3300014200 | Bog | SGVRPEGAYHLWREVPPGELSIDPVADERLGWATGWVEAS* |
| Ga0075342_11384271 | 3300014320 | Natural And Restored Wetlands | SNPNYSVRPDGAYHQWRKIPPRELSIDLVADERFCRATGRAGAS* |
| Ga0181522_104188842 | 3300014657 | Bog | LAVRPEGANYQWRKIPPRELSIDLEADERLGRVTGWVGAS* |
| Ga0137411_10212631 | 3300015052 | Vadose Zone Soil | PEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS* |
| Ga0137411_12086078 | 3300015052 | Vadose Zone Soil | AERTRLLLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS* |
| Ga0137412_106814431 | 3300015242 | Vadose Zone Soil | LFYPVRPEGANHQWRKIPSGKLSIGPVADERLGRATGRVGAS* |
| Ga0137409_100302764 | 3300015245 | Vadose Zone Soil | MCSQRPVMAVRPEGANHLWRRNPPRELSIDLVADGRFGRVTGRAGAS* |
| Ga0132256_1001371033 | 3300015372 | Arabidopsis Rhizosphere | MAILIVRPEGANHQWRKIPPGELSIDPVADERLGRVTGRAGAS* |
| Ga0132255_1002859073 | 3300015374 | Arabidopsis Rhizosphere | MSAGCRRLAVRPEGADHQWRKIPPGELSIDPEADEQLVRVTAWAEAS* |
| Ga0182036_101578862 | 3300016270 | Soil | MARRQLLAVRPEGANRQWRRNPPRELLIDLVADERLGRVTGRAGAS |
| Ga0182036_105819282 | 3300016270 | Soil | MAVRPEGANHQWRKNPPGELSIDPVADERLVRVTA |
| Ga0182041_107273871 | 3300016294 | Soil | VTGLFPVLAVRPEGANHQWRKNPPGELSIDPVADER |
| Ga0182041_113063472 | 3300016294 | Soil | MAVRPEGANHQWRRNPPRELSIDLVADERLGRVTG |
| Ga0182041_120162551 | 3300016294 | Soil | VRLEGACHQRRRIPPRELSIDLVADERLGRVTGRAEAS |
| Ga0182033_109951651 | 3300016319 | Soil | MAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS |
| Ga0182032_109844452 | 3300016357 | Soil | LMAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS |
| Ga0182034_101256904 | 3300016371 | Soil | LAVRPEGANHQWRKNPPRELSIDLVADERLDRVTGRAEAS |
| Ga0182040_104158031 | 3300016387 | Soil | MAVRREGANHQWRKNPHGELSIDPVADERLVRVTAWF |
| Ga0182040_106915792 | 3300016387 | Soil | MAVRPEGANHQWRRNPPRELSIDLVADERLGRVTGRAGAS |
| Ga0182037_105330654 | 3300016404 | Soil | AVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS |
| Ga0182037_112752951 | 3300016404 | Soil | MAVRLEGANHQWRKKPHGELSIDPVADERLVRVTAWVGA |
| Ga0182037_120093251 | 3300016404 | Soil | MSLVVAVRPEGAHHQWGRIPPGELSIDPVADERLVRATARVGA |
| Ga0182039_108052213 | 3300016422 | Soil | RPEGANHQWRKNPPGELSIDPVADERLVRVTARVGAS |
| Ga0182039_109310821 | 3300016422 | Soil | VAVRPEGANHRWGKNPPGELSIDPVADERLMRVTAWAGANS |
| Ga0182039_112805231 | 3300016422 | Soil | MSPVLAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGASRQRS |
| Ga0182039_113379772 | 3300016422 | Soil | MAVRPEGVNYQWRRNPPRKLSIDLVADERLGRVTGRAG |
| Ga0182039_114729741 | 3300016422 | Soil | EGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0182039_115894631 | 3300016422 | Soil | MAVRPEGANHQWRKIPHGELSIDPVADERLMRVTAW |
| Ga0182038_101810383 | 3300016445 | Soil | MAVRLEGANHQWRKKPHGELSIDPVADERLVRVTAWV |
| Ga0182038_105377131 | 3300016445 | Soil | LAVRPEGANHQWRKNPPGELSIDPVADERLMRVTAWAGAS |
| Ga0187802_100010981 | 3300017822 | Freshwater Sediment | VTRAECLLLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| Ga0187802_100537231 | 3300017822 | Freshwater Sediment | MPKCLLMAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRA |
| Ga0187802_102288891 | 3300017822 | Freshwater Sediment | VRPEGANYQWRKIPPRKLSIDLEADGRLGRVTGRA |
| Ga0187802_103349352 | 3300017822 | Freshwater Sediment | VLAVRPEGANHQWRKIPSGELSIDPEADERLGRVT |
| Ga0187856_11669091 | 3300017925 | Peatland | EGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS |
| Ga0187807_10212263 | 3300017926 | Freshwater Sediment | LAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| Ga0187824_100693663 | 3300017927 | Freshwater Sediment | CWNRKFGIGFILVRLEGACHQRRRVPPRELSIDLVADERLGRVTGRAEAS |
| Ga0187801_101735261 | 3300017933 | Freshwater Sediment | LAVRPEGANHQWRKIPPRELSIDLEADERLDRVTG |
| Ga0187801_104427752 | 3300017933 | Freshwater Sediment | MAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGR |
| Ga0187879_100138985 | 3300017946 | Peatland | MAVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS |
| Ga0187817_100675622 | 3300017955 | Freshwater Sediment | AVRPEGANHQWRKIPSGELSIDPEADERLGRVTDWAGAS |
| Ga0187817_107072902 | 3300017955 | Freshwater Sediment | MGRRCRLLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAG |
| Ga0187781_114726042 | 3300017972 | Tropical Peatland | AVRPEGANYLWRKNPPRELSIDLVADERLYRVTGRAGAS |
| Ga0187816_104744372 | 3300017995 | Freshwater Sediment | MPKCLLMAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGA |
| Ga0187816_104869082 | 3300017995 | Freshwater Sediment | MGRRCRLLAVRPEGANHQWRKIPPRELSIDLVADERLGRVANGAA |
| Ga0187804_105942951 | 3300018006 | Freshwater Sediment | MSALAVRPEGANHQWRKIPPRELSIDLVADERLGRVT |
| Ga0187882_13212921 | 3300018021 | Peatland | VHPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS |
| Ga0187889_101671182 | 3300018023 | Peatland | FVFVHVVMVSGVHPEGAYHLWREVPPGELSIDPVADERLGWATGRVEAS |
| Ga0184605_105288471 | 3300018027 | Groundwater Sediment | MAVRPEGADHQWRKIPLGELSIDPVADERLVRATA |
| Ga0187869_103126091 | 3300018030 | Peatland | VGCCASKETHRIAKICPVMAVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS |
| Ga0187862_105507791 | 3300018040 | Peatland | EGANHQWRKIPPRELSIDLEADERLDRVTGRAGAS |
| Ga0187862_106272912 | 3300018040 | Peatland | AVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS |
| Ga0187859_100204571 | 3300018047 | Peatland | MAVRPEGANHQWRKIPPRELSIDLEADERLGWETGQVEAS |
| Ga0184638_10318581 | 3300018052 | Groundwater Sediment | MSAHGSAPEGANHQWRKIPPGELSIDPVADERLVRATV |
| Ga0184619_102606712 | 3300018061 | Groundwater Sediment | AVRPEGANHQWRRNPPGELSIDPVADERLVWVTARVGAS |
| Ga0187784_101203861 | 3300018062 | Tropical Peatland | RLEGAYHLWRKIPSRELSIDLEADERFGWATGRAEAS |
| Ga0066662_115462992 | 3300018468 | Grasslands Soil | AVRPEGADHQWRRIPLGELSIDPVVDERLGRVTERAGAS |
| Ga0193611_10778912 | 3300018917 | Soil | PEGANHQWRKISPGELSIASVADERLGRVTDLVEAS |
| Ga0193616_11159501 | 3300018918 | Soil | LAQILICAVRPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS |
| Ga0193704_10093801 | 3300019867 | Soil | LLAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0193727_10524081 | 3300019886 | Soil | VRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0193728_11104381 | 3300019890 | Soil | YRAHPRLYVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0193718_10171482 | 3300019999 | Soil | AVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0193731_11135851 | 3300020001 | Soil | CRLLAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| Ga0193755_10253693 | 3300020004 | Soil | CRFLAVRPEGADHQWRKIPPGELSIDPVADERLVRATASAEAS |
| Ga0194120_100460873 | 3300020198 | Freshwater Lake | INPIYSVRPDGAQRLWREVPPRELSVDLVADERLDRETGRAEAS |
| Ga0194119_102757232 | 3300020220 | Freshwater Lake | RNLVPGSSPTYSVRPDGAQRLWREVPPRELSVDLVADERLDRETGRAEAS |
| Ga0210407_101220911 | 3300020579 | Soil | DDRPVMAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS |
| Ga0210407_108758552 | 3300020579 | Soil | PSSANALVGQLMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210407_112517452 | 3300020579 | Soil | MAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRA |
| Ga0210403_101080071 | 3300020580 | Soil | VPVMAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0210403_101404301 | 3300020580 | Soil | TRAGCLFLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210403_105237492 | 3300020580 | Soil | VRPEGANHQWRKIPPGELSIDPVADERLVRVTAWVGAS |
| Ga0210399_100400595 | 3300020581 | Soil | MRQNHKRLLLAVRPEGADHQWRKIPPRELSIDLVADERLG |
| Ga0210399_103679521 | 3300020581 | Soil | MSPFMAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAW |
| Ga0210395_101166181 | 3300020582 | Soil | LLLRYGSRVLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0210401_101841431 | 3300020583 | Soil | ELRYIPVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS |
| Ga0210401_103037481 | 3300020583 | Soil | LFCPLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210401_105977382 | 3300020583 | Soil | MAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210378_100363951 | 3300021073 | Groundwater Sediment | QVAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0210381_100107461 | 3300021078 | Groundwater Sediment | GRVGPELAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0210382_100317272 | 3300021080 | Groundwater Sediment | LAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0210380_101291171 | 3300021082 | Groundwater Sediment | MCLVLAVRPEGAITGGGIPPRELSIDLEADERSAG |
| Ga0210404_100496773 | 3300021088 | Soil | YYLAGPLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210406_101365881 | 3300021168 | Soil | MSLDLAVRPEGANHQWRKIPPGELSIDPVADERLVRVTAWVGAS |
| Ga0210406_101470193 | 3300021168 | Soil | ISHFMYVLVVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0210406_105358112 | 3300021168 | Soil | MSPVMAVRPEGANHQWRKNPPGELSIDPVADEQLMRVTA |
| Ga0210400_110450562 | 3300021170 | Soil | LAVRPEGANHQWRRIPPRELSIDLEADERFARATGR |
| Ga0210405_104390292 | 3300021171 | Soil | HWICRQVAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210408_101292411 | 3300021178 | Soil | LLAVRPEGANHQWRKIPPGELSIDPEADERLGRVTGSMKRATRLA |
| Ga0210408_102093651 | 3300021178 | Soil | MAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAW |
| Ga0210408_107188021 | 3300021178 | Soil | MAVRPEGADYQWRKIPPGDLSIDPVADERLVRVTARVGAS |
| Ga0210396_101778861 | 3300021180 | Soil | ELFMSYLLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0210396_102581271 | 3300021180 | Soil | LMLAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS |
| Ga0193699_102361871 | 3300021363 | Soil | RILAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| Ga0210393_101361983 | 3300021401 | Soil | PSPLLAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS |
| Ga0210397_100693141 | 3300021403 | Soil | FSGSQLLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0210397_107898971 | 3300021403 | Soil | LVFVSVRPEGACHQRRRVPPRELSIDLVADERLGRATARAEAS |
| Ga0210389_112639011 | 3300021404 | Soil | RLLMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210387_105430192 | 3300021405 | Soil | SRPLFCPLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210387_109847181 | 3300021405 | Soil | MAVRPEGANHQWRKIPPGELSIDPVVDERLGWVTGR |
| Ga0210383_101486791 | 3300021407 | Soil | MTSIRDECRLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210394_101249121 | 3300021420 | Soil | MSFECLEMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210384_101662013 | 3300021432 | Soil | ESECRLMAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS |
| Ga0210384_101671943 | 3300021432 | Soil | QRVSLLLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0210392_107570111 | 3300021475 | Soil | LAAECLAMAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0210402_101755803 | 3300021478 | Soil | RSLNVFQLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0210410_104344491 | 3300021479 | Soil | MLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRA |
| Ga0210410_105450952 | 3300021479 | Soil | GATAVCLMLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0210409_107777861 | 3300021559 | Soil | LHCMSLQMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAG |
| Ga0210409_114146251 | 3300021559 | Soil | PEGANHQWRKIPPGELLIDPVADERLVRVTAWVGAS |
| Ga0210409_114536381 | 3300021559 | Soil | MSQVVAVRPEGANHQWRRNPPGELSIDPVADERLM |
| Ga0210409_115205141 | 3300021559 | Soil | MLHRMSQQVAVRPEGANHQWRRIPPRELSIDLEAD |
| Ga0126371_100591781 | 3300021560 | Tropical Forest Soil | CPLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0126371_101549844 | 3300021560 | Tropical Forest Soil | RPEGADYQWRKIPLGELSIDPVADERLVRATARAGAS |
| Ga0242652_10007811 | 3300022510 | Soil | AVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0242658_12330762 | 3300022530 | Soil | LAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0224452_10198021 | 3300022534 | Groundwater Sediment | ECLLMAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0247785_10162692 | 3300022889 | Soil | CRRLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS |
| Ga0228598_10079031 | 3300024227 | Rhizosphere | RPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0209171_101844391 | 3300025320 | Iron-Sulfur Acid Spring | LLGRPPQPHLATACPLMAVRPEGANHLWRKIPPGELSIDPVADERLGWVTGRAGAS |
| Ga0209171_103727601 | 3300025320 | Iron-Sulfur Acid Spring | LAVRPEGANHLWRKIPPGELSIDPVADERLGWVTG |
| Ga0207930_10179641 | 3300025604 | Arctic Peat Soil | PSPTYSVRPDGAYYQRRKIPPRELSIDLVADERLVWATERAEAS |
| Ga0207642_105012681 | 3300025899 | Miscanthus Rhizosphere | ARPRLYVRPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS |
| Ga0207699_114608721 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPFLAVRPEGADHQWRKNPPGELSIDPVGDERLGRAPEGLEP |
| Ga0207684_101978661 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVRPEGANHLWRENPPRELSIDLVADERLGRVTGRA |
| Ga0207695_110971853 | 3300025913 | Corn Rhizosphere | RLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS |
| Ga0207646_104820131 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PTLAVRPEGANHLWRKIPPGELSIDPVADERLGWVTGRAGAS |
| Ga0207681_105276062 | 3300025923 | Switchgrass Rhizosphere | TQCRQVAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS |
| Ga0207709_100954851 | 3300025935 | Miscanthus Rhizosphere | SERLEMAVRPEGADHQWRRIPPRELSIDLVADERSGRATGRAGAS |
| Ga0207670_100549322 | 3300025936 | Switchgrass Rhizosphere | MSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS |
| Ga0207665_108823312 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MALLTVRPEGANHQWRKIPPRELSIDPVADERLGRV |
| Ga0207640_112714191 | 3300025981 | Corn Rhizosphere | SVRPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS |
| Ga0207677_100355773 | 3300026023 | Miscanthus Rhizosphere | LCQLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS |
| Ga0207702_101498243 | 3300026078 | Corn Rhizosphere | VAVLLHCICRLLAVRPEGADHQWRENPPGELSIDPVADERLVRVTVRVGAS |
| Ga0209840_10125671 | 3300026223 | Soil | RPDGAYHQWRKIPPRELSIDLVADERLVWATERAEAS |
| Ga0257176_10019031 | 3300026361 | Soil | LLVAVRPEGANHLWRRNPPRELSIDLVADERLGRATGRAGAS |
| Ga0257176_10565802 | 3300026361 | Soil | ILDHVEDLAVRPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGAS |
| Ga0207982_10004143 | 3300026886 | Soil | MAFLLHCMSPVMAVRPEGANHQWRRNPPGELSIDPVADERLVWVTARVGAS |
| Ga0207722_10009011 | 3300027003 | Tropical Forest Soil | LLAGLPAHIGFVLVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS |
| Ga0208365_10027222 | 3300027070 | Forest Soil | VRPEGANYLWRKNPPRELSIDLVADERFGRVTGRAGAS |
| Ga0208366_10019371 | 3300027073 | Forest Soil | GPRPLLAVRPEGANHQWRKIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0209213_10088362 | 3300027383 | Forest Soil | MSPELAVRPEGANHQWRKIPPRELSIDLVADERLGRVTG |
| Ga0208993_10547272 | 3300027480 | Forest Soil | RVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS |
| Ga0208984_10847952 | 3300027546 | Forest Soil | MSPVLAVRPEGANHQWRKIPPRELSIDLEADERLS |
| Ga0208044_11380451 | 3300027625 | Peatlands Soil | VIGFVLVRPEGACHQRRRVPPRKLSIDLVADERLGRATGR |
| Ga0209625_10494141 | 3300027635 | Forest Soil | MSPEVAVRPEGANHQWRKIPPGELSIDPVADERLMRVTAWVGAS |
| Ga0209217_10025741 | 3300027651 | Forest Soil | MSPEVAVRPEGANYLWRTNPPRELSIDLVADERLGR |
| Ga0208696_10996921 | 3300027696 | Peatlands Soil | PKECRLMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0209656_101282291 | 3300027812 | Bog Forest Soil | PVVAVRPEGANHQWRKNPPGELSIDPVADERLVRVAAWVGAS |
| Ga0209040_102888843 | 3300027824 | Bog Forest Soil | MSPLLAVRPEGANHQWRKNPPGELSIDPVADERLVRV |
| Ga0209180_104058872 | 3300027846 | Vadose Zone Soil | EGVCHQWRKEPPGELSIDPVADERLGRVTGRAEAS |
| Ga0209180_105316841 | 3300027846 | Vadose Zone Soil | FDLKPNAGPVLAVRPEGANHQWRKIPPGELSIDPVADERLVRATARVGAS |
| Ga0209180_107758522 | 3300027846 | Vadose Zone Soil | MAVRPEGADHQWRENPPRELSIDLVADERLGRVTG |
| Ga0209169_101681231 | 3300027879 | Soil | MAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0209590_109119591 | 3300027882 | Vadose Zone Soil | MAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRVGAS |
| Ga0209067_103938421 | 3300027898 | Watersheds | LQLAVRPEGANHQWRKIPPRQLSIDLEADERLSRVTGRAGAS |
| Ga0209583_100240831 | 3300027910 | Watersheds | IMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0209526_101050321 | 3300028047 | Forest Soil | MSLEVAVRPEGANHQWRRNPPGELSIDPVADERLMRV |
| Ga0209526_104211031 | 3300028047 | Forest Soil | MSPELAVRPEGANHQWRRNPPGELSIDPVADERLMR |
| Ga0209526_105069103 | 3300028047 | Forest Soil | MSPILAVRPEGANHQWRRNPPGELSIDPVADERLMR |
| Ga0268266_109124011 | 3300028379 | Switchgrass Rhizosphere | QSRLCQLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS |
| Ga0268266_110855681 | 3300028379 | Switchgrass Rhizosphere | MSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRV |
| Ga0307321_10406641 | 3300028704 | Soil | RSRECPFLAVRPEGADHQWRKIPPGELSIDPVADERLVRATASAEAS |
| Ga0307322_100101003 | 3300028710 | Soil | ALLECLDLAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0307309_100079872 | 3300028714 | Soil | LMAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0307288_100708551 | 3300028778 | Soil | KCPQVAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0307517_106537461 | 3300028786 | Ectomycorrhiza | GIDQAPLSRLAVRPEGANHQWRKIPLGELSIDPVADERLGRVTGRAGAS |
| Ga0307290_100256654 | 3300028791 | Soil | VKVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS |
| Ga0307504_100120811 | 3300028792 | Soil | AYRGGECLFMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0307284_100245903 | 3300028799 | Soil | LSGCPDMAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0307503_103024941 | 3300028802 | Soil | RPEGANHQWRKIPSRELSIELEADEQLGWATGRAGAS |
| Ga0307296_100603071 | 3300028819 | Soil | SPVLAVRPEGANHQWRKIPPGELSIDPVADERLGRATARAGAS |
| Ga0307310_100234143 | 3300028824 | Soil | LRECPFVAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0307289_101785491 | 3300028875 | Soil | HAGVGTESICQVLAVRPEGADHQWRKIPPGELSIDPEADERLVRATASAEAS |
| Ga0307289_102256031 | 3300028875 | Soil | TAKSAMAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| Ga0307289_104299062 | 3300028875 | Soil | MAVRPEGADHQWRKIPLGELSIDPVADERLVRATASA |
| Ga0307278_100481181 | 3300028878 | Soil | EGANHQWRKIPPGELSIDPVADERLGRATARAGAS |
| Ga0307300_100039356 | 3300028880 | Soil | LECLDLAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0307304_100274491 | 3300028885 | Soil | IDGCPAMAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS |
| Ga0311329_101651131 | 3300029907 | Bog | VRPDGAHHQWRKIPPRKVSIDLVADERFSRVTGWAGAS |
| Ga0311369_101547283 | 3300029910 | Palsa | PFMAVRPEGAKHQWRRVPPRELSIDLVADERFGRVTGRAGAS |
| Ga0311369_106656461 | 3300029910 | Palsa | CLLMAVRPEGANYQWRKIPPRELSIDLEADERLGRVTGWVGAS |
| Ga0311340_101927892 | 3300029943 | Palsa | LAVRPEGANYQWRKIPPRELSIDLVADERLDRVTGWAGAS |
| Ga0311338_101161141 | 3300030007 | Palsa | LSWRPLSFQAQRRLLAVRPEGANYQWRKIPPRELSIDLVADERLDRVTGWAGAS |
| Ga0311372_119317642 | 3300030520 | Palsa | LAVRPEGANYQWRKIPPRELSIDLEADERLGRVTG |
| Ga0265461_100773252 | 3300030743 | Soil | VAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS |
| Ga0075377_117616531 | 3300030844 | Soil | MAVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS |
| Ga0311366_111005041 | 3300030943 | Fen | LTVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS |
| Ga0075394_120207592 | 3300030969 | Soil | LAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0308183_10387661 | 3300030988 | Soil | EGANHQWRKISPGELSIASVADERLGRVTDLVEAS |
| Ga0308184_10274712 | 3300031095 | Soil | PVVAVRPEGANHQWRKIPPGELSIDPVADERFGRVTGRAGAS |
| Ga0308180_10216961 | 3300031100 | Soil | LMAVRPEGADHQWRKIPPRELSIDLEADERLGRVTGRAGAS |
| Ga0307499_100685431 | 3300031184 | Soil | LTKGRVLTVRPEGANHQWRKIPPGELSIDPVADERLGRVTGRAGAS |
| Ga0307500_102180901 | 3300031198 | Soil | EGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS |
| Ga0265325_100532641 | 3300031241 | Rhizosphere | ELRSTRARVRLDGAYHQWRKNPPGELSIDLVADERFDRVTGWAEAS |
| Ga0265331_101466981 | 3300031250 | Rhizosphere | AARVRLDGAYHQWRKNPPGELSIDLVADERFDRVTGWAEAS |
| Ga0170818_1048158151 | 3300031474 | Forest Soil | MAVRPEGANHQWRKIPPGELSIDPEADERLGRVTGRAGAS |
| Ga0302326_101276311 | 3300031525 | Palsa | QAQRRLLAVRPEGANYQWRKIPPRELSIDLVADERLDRVTGWAGAS |
| Ga0318541_100555381 | 3300031545 | Soil | VRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRAGAS |
| Ga0318571_101426862 | 3300031549 | Soil | QCICPLMAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318571_101439761 | 3300031549 | Soil | VRCLVVAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0318571_102537013 | 3300031549 | Soil | PEGADHQWRKIPPGELSIDPEADERLVRATARVGAS |
| Ga0318528_100590251 | 3300031561 | Soil | AVMSLLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS |
| Ga0318528_103682191 | 3300031561 | Soil | LMAERPEGAHHQWRKSPPGELSIDPVADERLVRVTARAGAS |
| Ga0318573_102056882 | 3300031564 | Soil | MAVRPEGANHQWRRNPPRELSIDLVADERPGRVTG |
| Ga0318515_106666672 | 3300031572 | Soil | WHGFAALHGPVMAVRLEGANHQWRKKPHGELSIDPVADERLVRVTAWVGAS |
| Ga0318515_106969611 | 3300031572 | Soil | VRPEGANHQWRRNPPRELSIDLVADERLGRVTGRAGAS |
| Ga0310915_101002051 | 3300031573 | Soil | PKPSARDGPLLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS |
| Ga0310915_102236661 | 3300031573 | Soil | IALCPLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0315534_10198721 | 3300031585 | Salt Marsh Sediment | MSPKVAVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS |
| Ga0315534_10466512 | 3300031585 | Salt Marsh Sediment | MAVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGANANLNA |
| Ga0315553_101193851 | 3300031652 | Salt Marsh Sediment | MAVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRA |
| Ga0318561_103221992 | 3300031679 | Soil | MAVRPEGANHQWRKNPPGKLSIDPVADERLVWATARVG |
| Ga0318574_100753081 | 3300031680 | Soil | RQLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0318574_103715912 | 3300031680 | Soil | RPGEKEFRAAIPLICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318572_100782225 | 3300031681 | Soil | AVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRAGAS |
| Ga0318572_100893622 | 3300031681 | Soil | LLHCICRLLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0318572_108132752 | 3300031681 | Soil | LMAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0310686_1086003571 | 3300031708 | Soil | MSFMAVRPEGANHQWRKIPPGELSIDPVANERLGW |
| Ga0265342_102145101 | 3300031712 | Rhizosphere | TAAKVRLDGAYHQWRKNPPGELSIDLVADERFDRVTGWAEAS |
| Ga0307474_102642822 | 3300031718 | Hardwood Forest Soil | PEGANHQWRKIPPGESSIDPVANERLGWVTGRAGAS |
| Ga0306917_102647561 | 3300031719 | Soil | EARCPLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0318493_100384741 | 3300031723 | Soil | GPEVAVRPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGAS |
| Ga0318493_106438172 | 3300031723 | Soil | LLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS |
| Ga0318501_100209056 | 3300031736 | Soil | MAVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRGRCLVTRVAVGG |
| Ga0306918_104152052 | 3300031744 | Soil | RCRSLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS |
| Ga0306918_109340232 | 3300031744 | Soil | MAVRPEGANHQWRRNPPRELSIDLVADERLGRVTGR |
| Ga0318502_106593532 | 3300031747 | Soil | LRCVSPVMAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318492_105550811 | 3300031748 | Soil | YRLMAVRLEGANHQWRKIPSGELSIDPEADERLSRVTGWAGAS |
| Ga0307477_106154262 | 3300031753 | Hardwood Forest Soil | MSAASESLLVAVRPEGANYLWRKNPPRELSIDLVADERLVRVTG |
| Ga0318554_100538461 | 3300031765 | Soil | LLHCICRLMAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0318509_100453771 | 3300031768 | Soil | IHKLVGRLPHLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0318509_103904073 | 3300031768 | Soil | SFHDQCPVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318546_110028041 | 3300031771 | Soil | LERQLLAVRLEGANHQWRKIPPGELSIDPEADERLGRVTGWAGAS |
| Ga0318543_103991332 | 3300031777 | Soil | VRPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGA |
| Ga0318498_100521011 | 3300031778 | Soil | LLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0318566_102910751 | 3300031779 | Soil | SPLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318508_10530941 | 3300031780 | Soil | SPELAVRPEGADYQWRKIPLGELSIDPVADERLVRATARAGAS |
| Ga0318508_11115492 | 3300031780 | Soil | PLLAVRPEGANHQWRRDPPRELSIDLVADERLVRVTGRAGAS |
| Ga0318547_102323121 | 3300031781 | Soil | IKEFGFVLVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS |
| Ga0318548_100959304 | 3300031793 | Soil | SLMAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318503_100131111 | 3300031794 | Soil | LLHCICRLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0318503_101392033 | 3300031794 | Soil | MRVCQFLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0318557_100363732 | 3300031795 | Soil | MLGTTMALSNSRELAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0318550_100194833 | 3300031797 | Soil | GLELAVRPEGANHQWRKNPPGELSIDPVADERLVRGTTWVGAS |
| Ga0318550_100442802 | 3300031797 | Soil | LLLHCTSPELAVRPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0318497_103625762 | 3300031805 | Soil | AAIPLICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0307473_108346881 | 3300031820 | Hardwood Forest Soil | FDVRPEGADHQWRKEPSGELSINPAADERLGRATGWAEAS |
| Ga0318567_106589162 | 3300031821 | Soil | MAVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRGRCLVTRVA |
| Ga0318499_101593422 | 3300031832 | Soil | VVAVRPEGAHHQWGRIPPGELSIDPVADERLVRATARVGAS |
| Ga0310917_106256301 | 3300031833 | Soil | RFLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318512_103182663 | 3300031846 | Soil | MAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGA |
| Ga0318512_103392051 | 3300031846 | Soil | FLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0306919_100269754 | 3300031879 | Soil | ACRLLAVRPEGANHLWRKNPPRELSIDLVADERLDRVTGRAGAS |
| Ga0306919_101090762 | 3300031879 | Soil | DLDKIGFVLVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS |
| Ga0306919_113611181 | 3300031879 | Soil | LAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS |
| Ga0318544_100273861 | 3300031880 | Soil | SLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS |
| Ga0318544_100967281 | 3300031880 | Soil | LLAVRPEGAHHQWGRIPPGELSIDPVADERLVGATARVGAS |
| Ga0318544_101507272 | 3300031880 | Soil | HCMSPLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0306925_103483251 | 3300031890 | Soil | MAVRPEGADHQWRKNPPGELSIDPVADERLVRVTARA |
| Ga0306925_112923041 | 3300031890 | Soil | MAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0306925_118062551 | 3300031890 | Soil | MAVRPEGANHQWRKNPHGELSIDPVVDERLVRVTAWVGAS |
| Ga0306925_119248452 | 3300031890 | Soil | MAVRPEGANHLWRKKPPRELSIDLVADERLGRVTE |
| Ga0306925_120138051 | 3300031890 | Soil | LAVRPEGADYQWRKIPLGELSIDPVADERLVRATARAGA |
| Ga0318551_100620173 | 3300031896 | Soil | VRLEGANHQWRKIPSGELSIDPEADERLSRVTGWAGAS |
| Ga0318551_100950191 | 3300031896 | Soil | ISPLMAVRPEGANHQWRKNPPRELSIDLVADERLDRVTGRAEAS |
| Ga0306923_100183911 | 3300031910 | Soil | PALAVRPEGANHQWRKNPPGELSIGPVADERLVRVTAWVGAS |
| Ga0306923_101442831 | 3300031910 | Soil | MAVRPEGANHQWRKNPPGELSIDPVADERLVRGTTWVGAS |
| Ga0306923_102794292 | 3300031910 | Soil | KLAVRLEGANHQWRKIPSGELSIDPEADERLSRVTGWAGAS |
| Ga0306923_109815541 | 3300031910 | Soil | MAVRPEGANHLWRKKPPRELSIDLVADERLGRVTGR |
| Ga0306921_110746231 | 3300031912 | Soil | FVSVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS |
| Ga0310912_101214672 | 3300031941 | Soil | LQIKAAHDEVRCRRLAVRLEGANHQWRKIPPGELSIDPEADERLGRVTGWAGAS |
| Ga0310916_100951441 | 3300031942 | Soil | CECLLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0310916_101443341 | 3300031942 | Soil | SAGQCRLMAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS |
| Ga0310916_107150871 | 3300031942 | Soil | MAVRPEGANHQWRKNPHGELSIDPVADERLVRVTAW |
| Ga0310916_108025473 | 3300031942 | Soil | IPLICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0310916_116176571 | 3300031942 | Soil | CRLMAVRPEGANHLWRKNPPRNLPISLVADERGSAG |
| Ga0310913_100793231 | 3300031945 | Soil | MAVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRGRCLVT |
| Ga0310913_101025941 | 3300031945 | Soil | QVAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS |
| Ga0310913_103157261 | 3300031945 | Soil | VAVRPEGANHRWGKNPPGELSIDPVADERLMRVTAWAGANSIDVGT |
| Ga0310910_106171853 | 3300031946 | Soil | SRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0310909_111971053 | 3300031947 | Soil | MSALAVRPEGADYQWRKIAPGELSIDPVADERLVRA |
| Ga0306926_104991891 | 3300031954 | Soil | LAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0306926_108580781 | 3300031954 | Soil | MAVRPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGA |
| Ga0306926_108698371 | 3300031954 | Soil | MAERPEGADYQWRKIPLGELSIDPVADERLVRVTARA |
| Ga0306926_112046402 | 3300031954 | Soil | LENGFVSVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS |
| Ga0307479_101925641 | 3300031962 | Hardwood Forest Soil | RLIAAPACPQMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0307479_109249212 | 3300031962 | Hardwood Forest Soil | VGDMSAASESLLVAVRPEGANYLWRKNPPRELSIDLVADERLVRVTGRAGAS |
| Ga0318531_100401251 | 3300031981 | Soil | CPLLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0318531_100883751 | 3300031981 | Soil | PLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS |
| Ga0306922_102252971 | 3300032001 | Soil | RPLSPLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS |
| Ga0306922_111136061 | 3300032001 | Soil | MAVRPEGADYQWRKIAPGELSIDPVADERLVRATAR |
| Ga0318563_102115671 | 3300032009 | Soil | VRPEGADHQWRKIPPGELSIDPEADEQLVRVTAWAEAS |
| Ga0318563_104011992 | 3300032009 | Soil | PDQMSALAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0310902_101977532 | 3300032012 | Soil | EGADYQWRKIPPGELSIDPEADGRLVRVTAWAEAS |
| Ga0318507_102890173 | 3300032025 | Soil | CICPLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0310911_100642741 | 3300032035 | Soil | LLLLLRCVGPLMAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0318559_102914011 | 3300032039 | Soil | LLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0318549_102349402 | 3300032041 | Soil | SRFKRPVAGIDTSDLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318549_103481751 | 3300032041 | Soil | LAVRPEGANHQWRKNPPGELSIDPVADERLVRVTARVGAS |
| Ga0318558_100244866 | 3300032044 | Soil | MAVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRAGAS |
| Ga0318558_103523241 | 3300032044 | Soil | MSLVVAVRPEGVHHQWGRIPPGELSIDPVADERLVRATARVGAS |
| Ga0318558_103723463 | 3300032044 | Soil | ICRFLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318532_101799871 | 3300032051 | Soil | LLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318532_103146091 | 3300032051 | Soil | VAVRRRVGERPLLAVRPEGANHQWRRNPPRELSIDLVADERLGRVTGRAGAS |
| Ga0318506_100349673 | 3300032052 | Soil | CLLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS |
| Ga0318506_101800842 | 3300032052 | Soil | VDPMDRRCPLLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS |
| Ga0318506_103576971 | 3300032052 | Soil | QCLLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318570_101487081 | 3300032054 | Soil | MAVRPEGANHQWRKNPPGELSIDPVADERLVRVTARVGAS |
| Ga0318575_106148241 | 3300032055 | Soil | MSLVVAVRPEGAHHQWGRIPPGELSIDPVADERLVRATARVG |
| Ga0318575_106831642 | 3300032055 | Soil | MAERPEGTHHQWRKIPPGELSIDPVADERLVRVTARAGAS |
| Ga0318533_101041083 | 3300032059 | Soil | PWMSVRGTGHLLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS |
| Ga0318533_101566661 | 3300032059 | Soil | LLRCISPLLAERPEGADYQWRKIPLGELSIDPVADERLVRVTA |
| Ga0318533_111733952 | 3300032059 | Soil | ILLQCISPFLAVRPEGANHQWRKNPPGELSIDPVANERLVRVTAWVGAS |
| Ga0318510_102264093 | 3300032064 | Soil | PLICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318514_100337941 | 3300032066 | Soil | SSGCPTMAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS |
| Ga0306924_100517645 | 3300032076 | Soil | MARRQLLAVRPEGANRQWRRNPPRELLIDLVADEQLGRVTGRAGAS |
| Ga0306924_102528931 | 3300032076 | Soil | LMAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS |
| Ga0306924_103453153 | 3300032076 | Soil | VAVRPEGANHRWGKNPPGELSIDPVADERLMRVTA |
| Ga0306924_112351052 | 3300032076 | Soil | LICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0306924_117254891 | 3300032076 | Soil | VRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGA |
| Ga0306924_117603581 | 3300032076 | Soil | VTGLFPVLAVRPEGANHRWGKNPPGELSIDPVADER |
| Ga0326721_100428912 | 3300032080 | Soil | FDFKTKSGEGQEMAVRPEGADHQWRRIPSRELSIDLVADERFGRVTGRAGAS |
| Ga0318518_103381962 | 3300032090 | Soil | GIDTSDLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS |
| Ga0318540_100390193 | 3300032094 | Soil | NMSAPMVRPEGVHHPWRKIPPRELSIDLVADERFGRAIERTEAS |
| Ga0318540_101415172 | 3300032094 | Soil | MSPVLAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVG |
| Ga0311301_102042491 | 3300032160 | Peatlands Soil | LAVRPEGANHQWRKIPPRELSIDLEADERFGWATGWA |
| Ga0311301_115232021 | 3300032160 | Peatlands Soil | AVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS |
| Ga0307472_1001004381 | 3300032205 | Hardwood Forest Soil | EGELARAALWSRLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS |
| Ga0307472_1005537341 | 3300032205 | Hardwood Forest Soil | LHCVCRLLAVRPEGADHQWRKNPPGELSIDPVADERLVQVTVRVGAS |
| Ga0307472_1009640541 | 3300032205 | Hardwood Forest Soil | QLAVRPEGANHQWRKNPPGELSIDPVADERLVRATARAGAS |
| Ga0306920_1004003363 | 3300032261 | Soil | RLRQQCLRLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS |
| Ga0306920_1011412141 | 3300032261 | Soil | MAVRPEGANHQWRKNPPGELSIDPVADERLMRVTAWAG |
| Ga0306920_1016085561 | 3300032261 | Soil | LAVRPEGADYQWRKIPLGELSIDPVADERLVRATA |
| Ga0306920_1024199342 | 3300032261 | Soil | MSPELAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAG |
| Ga0306920_1033324271 | 3300032261 | Soil | GDRVTGLFPVLAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWAGAS |
| Ga0335076_100802994 | 3300032955 | Soil | ANAGGDERKKCGLTVRPEGACHQWRKVPPRELSIDLVADEQFERVIGWTGAS |
| Ga0247829_108017531 | 3300033550 | Soil | VVLPERLKMAVRPEGADHRWRRIPPRELSIDLVADERFGRATGRAGAS |
| ⦗Top⦘ |