NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F003222

Metagenome Family F003222

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F003222
Family Type Metagenome
Number of Sequences 499
Average Sequence Length 41 residues
Representative Sequence MRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA
Number of Associated Samples 83
Number of Associated Scaffolds 497

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 89.34 %
% of genes near scaffold ends (potentially truncated) 22.85 %
% of genes from short scaffolds (< 2000 bps) 64.33 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (74.950 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Root
(64.730 % of family members)
Environment Ontology (ENVO) Unclassified
(97.796 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(67.535 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.67%    β-sheet: 0.00%    Coil/Unstructured: 58.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 497 Family Scaffolds
PF00078RVT_1 2.01
PF00665rve 1.21
PF04195Transposase_28 0.80
PF13456RVT_3 0.80
PF03732Retrotrans_gag 0.80
PF08284RVP_2 0.80
PF07727RVT_2 0.60
PF13976gag_pre-integrs 0.60
PF00931NB-ARC 0.40
PF13966zf-RVT 0.40
PF13960DUF4218 0.40
PF04937DUF659 0.40
PF13041PPR_2 0.20
PF00515TPR_1 0.20
PF00067p450 0.20
PF00248Aldo_ket_red 0.20
PF10536PMD 0.20
PF13405EF-hand_6 0.20
PF13650Asp_protease_2 0.20
PF03357Snf7 0.20
PF03017Transposase_23 0.20
PF14223Retrotran_gag_2 0.20
PF00733Asn_synthase 0.20
PF04146YTH 0.20
PF00326Peptidase_S9 0.20
PF14111DUF4283 0.20
PF04827Plant_tran 0.20
PF06136SOK 0.20
PF02992Transposase_21 0.20
PF03055RPE65 0.20
PF00098zf-CCHC 0.20
PF13912zf-C2H2_6 0.20
PF16275SF1-HH 0.20
PF13359DDE_Tnp_4 0.20
PF14226DIOX_N 0.20
PF02892zf-BED 0.20
PF00190Cupin_1 0.20
PF02135zf-TAZ 0.20
PF02365NAM 0.20
PF01737Ycf9 0.20

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 497 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.21
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.21
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.21
COG4584TransposaseMobilome: prophages, transposons [X] 1.21
COG2124Cytochrome P450Defense mechanisms [V] 0.20
COG3670Carotenoid cleavage dioxygenase or a related enzymeSecondary metabolites biosynthesis, transport and catabolism [Q] 0.20
COG5491Archaeal cell division protein CdvB, Snf7/Vps24/ESCRT-III familyCell cycle control, cell division, chromosome partitioning [D] 0.20


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.38 %
UnclassifiedrootN/A7.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2009439000|bisonPool14jan08_BXAW4532_x1All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor677Open in IMG/M
3300000156|NODE_c0490209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor993Open in IMG/M
3300005288|Ga0065714_10045125All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis645Open in IMG/M
3300005543|Ga0070672_101063115All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei718Open in IMG/M
3300005719|Ga0068861_101225942All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei726Open in IMG/M
3300009036|Ga0105244_10256686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor814Open in IMG/M
3300009989|Ga0105131_111336All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei775Open in IMG/M
3300009995|Ga0105139_1079712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300013296|Ga0157374_11362303All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei732Open in IMG/M
3300013297|Ga0157378_12910305All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei531Open in IMG/M
3300014486|Ga0182004_10000053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta41092Open in IMG/M
3300014486|Ga0182004_10000065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae39061Open in IMG/M
3300014486|Ga0182004_10000477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida24379Open in IMG/M
3300014486|Ga0182004_10000542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae23627Open in IMG/M
3300014486|Ga0182004_10000672All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae22143Open in IMG/M
3300014486|Ga0182004_10001123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae18876Open in IMG/M
3300014486|Ga0182004_10001142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta18805Open in IMG/M
3300014486|Ga0182004_10001334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor17829Open in IMG/M
3300014486|Ga0182004_10002054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae15418Open in IMG/M
3300014486|Ga0182004_10002246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor14890Open in IMG/M
3300014486|Ga0182004_10002365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae14605Open in IMG/M
3300014486|Ga0182004_10002376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae14571Open in IMG/M
3300014486|Ga0182004_10002431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae14464Open in IMG/M
3300014486|Ga0182004_10002467All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae14398Open in IMG/M
3300014486|Ga0182004_10002775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor13737Open in IMG/M
3300014486|Ga0182004_10002912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae13487Open in IMG/M
3300014486|Ga0182004_10002914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae13482Open in IMG/M
3300014486|Ga0182004_10003213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae12960Open in IMG/M
3300014486|Ga0182004_10003333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae12779Open in IMG/M
3300014486|Ga0182004_10003438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae12589Open in IMG/M
3300014486|Ga0182004_10003593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae12356Open in IMG/M
3300014486|Ga0182004_10003786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida12096Open in IMG/M
3300014486|Ga0182004_10004513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae11238Open in IMG/M
3300014486|Ga0182004_10004575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor11165Open in IMG/M
3300014486|Ga0182004_10004616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta11136Open in IMG/M
3300014486|Ga0182004_10004692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor11053Open in IMG/M
3300014486|Ga0182004_10005110All Organisms → cellular organisms → Eukaryota10674Open in IMG/M
3300014486|Ga0182004_10005135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor10648Open in IMG/M
3300014486|Ga0182004_10005476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae10335Open in IMG/M
3300014486|Ga0182004_10005557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae10267Open in IMG/M
3300014486|Ga0182004_10005808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae10053Open in IMG/M
3300014486|Ga0182004_10005920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae9961Open in IMG/M
3300014486|Ga0182004_10006033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae9883Open in IMG/M
3300014486|Ga0182004_10006178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor9773Open in IMG/M
3300014486|Ga0182004_10006182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae9770Open in IMG/M
3300014486|Ga0182004_10006184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor9768Open in IMG/M
3300014486|Ga0182004_10006287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta9702Open in IMG/M
3300014486|Ga0182004_10006289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae9700Open in IMG/M
3300014486|Ga0182004_10006577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae9484Open in IMG/M
3300014486|Ga0182004_10006963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae9222Open in IMG/M
3300014486|Ga0182004_10007064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae9151Open in IMG/M
3300014486|Ga0182004_10007124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor9115Open in IMG/M
3300014486|Ga0182004_10007629Not Available8800Open in IMG/M
3300014486|Ga0182004_10007840Not Available8695Open in IMG/M
3300014486|Ga0182004_10007962All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor8626Open in IMG/M
3300014486|Ga0182004_10008360All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae8418Open in IMG/M
3300014486|Ga0182004_10008717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae8231Open in IMG/M
3300014486|Ga0182004_10008727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor8227Open in IMG/M
3300014486|Ga0182004_10008730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius8227Open in IMG/M
3300014486|Ga0182004_10008738All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens8224Open in IMG/M
3300014486|Ga0182004_10008797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta8190Open in IMG/M
3300014486|Ga0182004_10009023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae8085Open in IMG/M
3300014486|Ga0182004_10009431All Organisms → cellular organisms → Eukaryota7893Open in IMG/M
3300014486|Ga0182004_10009961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae7667Open in IMG/M
3300014486|Ga0182004_10010334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7513Open in IMG/M
3300014486|Ga0182004_10010506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor7447Open in IMG/M
3300014486|Ga0182004_10010549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor7434Open in IMG/M
3300014486|Ga0182004_10010636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor7407Open in IMG/M
3300014486|Ga0182004_10010688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor7386Open in IMG/M
3300014486|Ga0182004_10011014All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae7267Open in IMG/M
3300014486|Ga0182004_10011314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta7155Open in IMG/M
3300014486|Ga0182004_10011842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum6971Open in IMG/M
3300014486|Ga0182004_10011871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae6964Open in IMG/M
3300014486|Ga0182004_10012424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae6787Open in IMG/M
3300014486|Ga0182004_10013317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae6515Open in IMG/M
3300014486|Ga0182004_10013594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6434Open in IMG/M
3300014486|Ga0182004_10014134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera6282Open in IMG/M
3300014486|Ga0182004_10014170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor6275Open in IMG/M
3300014486|Ga0182004_10014426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae6206Open in IMG/M
3300014486|Ga0182004_10014426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae6206Open in IMG/M
3300014486|Ga0182004_10015273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor5996Open in IMG/M
3300014486|Ga0182004_10015347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor5978Open in IMG/M
3300014486|Ga0182004_10015670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae5898Open in IMG/M
3300014486|Ga0182004_10015673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor5897Open in IMG/M
3300014486|Ga0182004_10015769All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei5873Open in IMG/M
3300014486|Ga0182004_10015919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor5843Open in IMG/M
3300014486|Ga0182004_10016623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5684Open in IMG/M
3300014486|Ga0182004_10016658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae5679Open in IMG/M
3300014486|Ga0182004_10016855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae5638Open in IMG/M
3300014486|Ga0182004_10017244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae5553Open in IMG/M
3300014486|Ga0182004_10017396Not Available5526Open in IMG/M
3300014486|Ga0182004_10018087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor5394Open in IMG/M
3300014486|Ga0182004_10018667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae5288Open in IMG/M
3300014486|Ga0182004_10018714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei5281Open in IMG/M
3300014486|Ga0182004_10019216All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae5194Open in IMG/M
3300014486|Ga0182004_10019626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae5125Open in IMG/M
3300014486|Ga0182004_10019705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum5108Open in IMG/M
3300014486|Ga0182004_10020135Not Available5029Open in IMG/M
3300014486|Ga0182004_10020198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5019Open in IMG/M
3300014486|Ga0182004_10020351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4995Open in IMG/M
3300014486|Ga0182004_10020779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae4928Open in IMG/M
3300014486|Ga0182004_10021334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4839Open in IMG/M
3300014486|Ga0182004_10021790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae4773Open in IMG/M
3300014486|Ga0182004_10022083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4728Open in IMG/M
3300014486|Ga0182004_10022284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae4700Open in IMG/M
3300014486|Ga0182004_10022655All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae4648Open in IMG/M
3300014486|Ga0182004_10022803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4626Open in IMG/M
3300014486|Ga0182004_10023801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4488Open in IMG/M
3300014486|Ga0182004_10025350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4278Open in IMG/M
3300014486|Ga0182004_10025395All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4271Open in IMG/M
3300014486|Ga0182004_10026488All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae4141Open in IMG/M
3300014486|Ga0182004_10026719All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4115Open in IMG/M
3300014486|Ga0182004_10026804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4104Open in IMG/M
3300014486|Ga0182004_10027133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4064Open in IMG/M
3300014486|Ga0182004_10027133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4064Open in IMG/M
3300014486|Ga0182004_10027601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor4011Open in IMG/M
3300014486|Ga0182004_10027812All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei3984Open in IMG/M
3300014486|Ga0182004_10028447All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3915Open in IMG/M
3300014486|Ga0182004_10028806All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor3875Open in IMG/M
3300014486|Ga0182004_10028892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor3865Open in IMG/M
3300014486|Ga0182004_10029486All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor3806Open in IMG/M
3300014486|Ga0182004_10029610All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei3794Open in IMG/M
3300014486|Ga0182004_10029874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae3768Open in IMG/M
3300014486|Ga0182004_10030560All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei3706Open in IMG/M
3300014486|Ga0182004_10030957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae3672Open in IMG/M
3300014486|Ga0182004_10031680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor3606Open in IMG/M
3300014486|Ga0182004_10033288All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei3466Open in IMG/M
3300014486|Ga0182004_10033927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor3412Open in IMG/M
3300014486|Ga0182004_10035093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae3323Open in IMG/M
3300014486|Ga0182004_10035387Not Available3301Open in IMG/M
3300014486|Ga0182004_10035784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor3271Open in IMG/M
3300014486|Ga0182004_10036977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae3188Open in IMG/M
3300014486|Ga0182004_10038026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae3116Open in IMG/M
3300014486|Ga0182004_10038579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei3079Open in IMG/M
3300014486|Ga0182004_10039201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor3037Open in IMG/M
3300014486|Ga0182004_10039404All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor3024Open in IMG/M
3300014486|Ga0182004_10039425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor3024Open in IMG/M
3300014486|Ga0182004_10040307All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei2970Open in IMG/M
3300014486|Ga0182004_10041777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2879Open in IMG/M
3300014486|Ga0182004_10041811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2877Open in IMG/M
3300014486|Ga0182004_10042240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2852Open in IMG/M
3300014486|Ga0182004_10042686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2826Open in IMG/M
3300014486|Ga0182004_10042751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2822Open in IMG/M
3300014486|Ga0182004_10042895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2813Open in IMG/M
3300014486|Ga0182004_10043539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2776Open in IMG/M
3300014486|Ga0182004_10043759All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2764Open in IMG/M
3300014486|Ga0182004_10044034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2748Open in IMG/M
3300014486|Ga0182004_10044883Not Available2705Open in IMG/M
3300014486|Ga0182004_10046111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae2641Open in IMG/M
3300014486|Ga0182004_10046146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2639Open in IMG/M
3300014486|Ga0182004_10046768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2606Open in IMG/M
3300014486|Ga0182004_10047546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2568Open in IMG/M
3300014486|Ga0182004_10047816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2556Open in IMG/M
3300014486|Ga0182004_10048107All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei2542Open in IMG/M
3300014486|Ga0182004_10048341All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei2531Open in IMG/M
3300014486|Ga0182004_10049590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2471Open in IMG/M
3300014486|Ga0182004_10049871All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei2457Open in IMG/M
3300014486|Ga0182004_10049958Not Available2453Open in IMG/M
3300014486|Ga0182004_10050225All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2442Open in IMG/M
3300014486|Ga0182004_10050881All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2415Open in IMG/M
3300014486|Ga0182004_10050978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2411Open in IMG/M
3300014486|Ga0182004_10051436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa2393Open in IMG/M
3300014486|Ga0182004_10051820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2377Open in IMG/M
3300014486|Ga0182004_10052260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2358Open in IMG/M
3300014486|Ga0182004_10052477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae2349Open in IMG/M
3300014486|Ga0182004_10052494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae2348Open in IMG/M
3300014486|Ga0182004_10052912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2331Open in IMG/M
3300014486|Ga0182004_10052923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2331Open in IMG/M
3300014486|Ga0182004_10053626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2303Open in IMG/M
3300014486|Ga0182004_10054158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae2284Open in IMG/M
3300014486|Ga0182004_10055146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2245Open in IMG/M
3300014486|Ga0182004_10055784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2220Open in IMG/M
3300014486|Ga0182004_10056141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2207Open in IMG/M
3300014486|Ga0182004_10056360All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2199Open in IMG/M
3300014486|Ga0182004_10057787All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei2149Open in IMG/M
3300014486|Ga0182004_10057789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2149Open in IMG/M
3300014486|Ga0182004_10059674All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2086Open in IMG/M
3300014486|Ga0182004_10059949All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2077Open in IMG/M
3300014486|Ga0182004_10060011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2075Open in IMG/M
3300014486|Ga0182004_10060229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2068Open in IMG/M
3300014486|Ga0182004_10060414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2061Open in IMG/M
3300014486|Ga0182004_10060599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2056Open in IMG/M
3300014486|Ga0182004_10061080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2041Open in IMG/M
3300014486|Ga0182004_10061358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2031Open in IMG/M
3300014486|Ga0182004_10061854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2016Open in IMG/M
3300014486|Ga0182004_10063063All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1979Open in IMG/M
3300014486|Ga0182004_10063400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius1969Open in IMG/M
3300014486|Ga0182004_10064002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1952Open in IMG/M
3300014486|Ga0182004_10064657All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1932Open in IMG/M
3300014486|Ga0182004_10065137All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1919Open in IMG/M
3300014486|Ga0182004_10065497All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1907Open in IMG/M
3300014486|Ga0182004_10066540All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1878Open in IMG/M
3300014486|Ga0182004_10066554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1878Open in IMG/M
3300014486|Ga0182004_10067623All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1851Open in IMG/M
3300014486|Ga0182004_10068247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1836Open in IMG/M
3300014486|Ga0182004_10068581Not Available1827Open in IMG/M
3300014486|Ga0182004_10069152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1812Open in IMG/M
3300014486|Ga0182004_10069479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1804Open in IMG/M
3300014486|Ga0182004_10069735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae1798Open in IMG/M
3300014486|Ga0182004_10069965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1793Open in IMG/M
3300014486|Ga0182004_10070091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1790Open in IMG/M
3300014486|Ga0182004_10070307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1785Open in IMG/M
3300014486|Ga0182004_10071721All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1752Open in IMG/M
3300014486|Ga0182004_10072332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1737Open in IMG/M
3300014486|Ga0182004_10072394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1735Open in IMG/M
3300014486|Ga0182004_10074997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1680Open in IMG/M
3300014486|Ga0182004_10077222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1634Open in IMG/M
3300014486|Ga0182004_10079198All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1596Open in IMG/M
3300014486|Ga0182004_10079493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1590Open in IMG/M
3300014486|Ga0182004_10081574All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1552Open in IMG/M
3300014486|Ga0182004_10081649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1550Open in IMG/M
3300014486|Ga0182004_10082104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1542Open in IMG/M
3300014486|Ga0182004_10082409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1537Open in IMG/M
3300014486|Ga0182004_10082550All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1535Open in IMG/M
3300014486|Ga0182004_10084114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1507Open in IMG/M
3300014486|Ga0182004_10084803All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1495Open in IMG/M
3300014486|Ga0182004_10085215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1489Open in IMG/M
3300014486|Ga0182004_10087855All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1446Open in IMG/M
3300014486|Ga0182004_10088021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1444Open in IMG/M
3300014486|Ga0182004_10088334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1439Open in IMG/M
3300014486|Ga0182004_10088600All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1435Open in IMG/M
3300014486|Ga0182004_10089196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1426Open in IMG/M
3300014486|Ga0182004_10089410All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1423Open in IMG/M
3300014486|Ga0182004_10089466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1422Open in IMG/M
3300014486|Ga0182004_10089797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1416Open in IMG/M
3300014486|Ga0182004_10091418All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1392Open in IMG/M
3300014486|Ga0182004_10091812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1387Open in IMG/M
3300014486|Ga0182004_10091920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1385Open in IMG/M
3300014486|Ga0182004_10093821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1359Open in IMG/M
3300014486|Ga0182004_10094646All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1347Open in IMG/M
3300014486|Ga0182004_10096315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1324Open in IMG/M
3300014486|Ga0182004_10097273All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1312Open in IMG/M
3300014486|Ga0182004_10098835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1293Open in IMG/M
3300014486|Ga0182004_10098956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1291Open in IMG/M
3300014486|Ga0182004_10100680All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1271Open in IMG/M
3300014486|Ga0182004_10101072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1266Open in IMG/M
3300014486|Ga0182004_10101184All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1265Open in IMG/M
3300014486|Ga0182004_10101708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1260Open in IMG/M
3300014486|Ga0182004_10102488All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1250Open in IMG/M
3300014486|Ga0182004_10103071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1243Open in IMG/M
3300014486|Ga0182004_10103136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1242Open in IMG/M
3300014486|Ga0182004_10103891All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1234Open in IMG/M
3300014486|Ga0182004_10108766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1182Open in IMG/M
3300014486|Ga0182004_10108767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1182Open in IMG/M
3300014486|Ga0182004_10109734All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1172Open in IMG/M
3300014486|Ga0182004_10112306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1147Open in IMG/M
3300014486|Ga0182004_10115179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1120Open in IMG/M
3300014486|Ga0182004_10115821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1114Open in IMG/M
3300014486|Ga0182004_10117619All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1098Open in IMG/M
3300014486|Ga0182004_10120861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1071Open in IMG/M
3300014486|Ga0182004_10131561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor990Open in IMG/M
3300014486|Ga0182004_10134502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor970Open in IMG/M
3300014486|Ga0182004_10135374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor964Open in IMG/M
3300014486|Ga0182004_10135690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor962Open in IMG/M
3300014486|Ga0182004_10141699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor924Open in IMG/M
3300014486|Ga0182004_10142838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor918Open in IMG/M
3300014486|Ga0182004_10143464All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor914Open in IMG/M
3300014486|Ga0182004_10144777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor907Open in IMG/M
3300014486|Ga0182004_10146046All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius900Open in IMG/M
3300014486|Ga0182004_10146290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor898Open in IMG/M
3300014486|Ga0182004_10147801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae890Open in IMG/M
3300014486|Ga0182004_10148398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor887Open in IMG/M
3300014486|Ga0182004_10149105All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei883Open in IMG/M
3300014486|Ga0182004_10149907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor879Open in IMG/M
3300014486|Ga0182004_10151290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor872Open in IMG/M
3300014486|Ga0182004_10151439All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius871Open in IMG/M
3300014486|Ga0182004_10154692All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei855Open in IMG/M
3300014486|Ga0182004_10155870All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei849Open in IMG/M
3300014486|Ga0182004_10156482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor846Open in IMG/M
3300014486|Ga0182004_10156940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor844Open in IMG/M
3300014486|Ga0182004_10157281All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei842Open in IMG/M
3300014486|Ga0182004_10158699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae836Open in IMG/M
3300014486|Ga0182004_10159564All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei832Open in IMG/M
3300014486|Ga0182004_10161447All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor823Open in IMG/M
3300014486|Ga0182004_10162732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor818Open in IMG/M
3300014486|Ga0182004_10166714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor801Open in IMG/M
3300014486|Ga0182004_10167137All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor799Open in IMG/M
3300014486|Ga0182004_10168033All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei795Open in IMG/M
3300014486|Ga0182004_10168186All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens795Open in IMG/M
3300014486|Ga0182004_10169682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae788Open in IMG/M
3300014486|Ga0182004_10175726All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor765Open in IMG/M
3300014486|Ga0182004_10176485All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor762Open in IMG/M
3300014486|Ga0182004_10176510All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor762Open in IMG/M
3300014486|Ga0182004_10179825All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei750Open in IMG/M
3300014486|Ga0182004_10181682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor743Open in IMG/M
3300014486|Ga0182004_10184836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor732Open in IMG/M
3300014486|Ga0182004_10186217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor728Open in IMG/M
3300014486|Ga0182004_10188481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor721Open in IMG/M
3300014486|Ga0182004_10189012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor719Open in IMG/M
3300014486|Ga0182004_10190853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor713Open in IMG/M
3300014486|Ga0182004_10192461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor708Open in IMG/M
3300014486|Ga0182004_10199633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa687Open in IMG/M
3300014486|Ga0182004_10201865All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae681Open in IMG/M
3300014486|Ga0182004_10203328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor677Open in IMG/M
3300014486|Ga0182004_10205096All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei672Open in IMG/M
3300014486|Ga0182004_10210125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei659Open in IMG/M
3300014486|Ga0182004_10212376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis653Open in IMG/M
3300014486|Ga0182004_10212441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor653Open in IMG/M
3300014486|Ga0182004_10213175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor651Open in IMG/M
3300014486|Ga0182004_10226353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor621Open in IMG/M
3300014486|Ga0182004_10229560All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor614Open in IMG/M
3300014486|Ga0182004_10229708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae613Open in IMG/M
3300014486|Ga0182004_10234132All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei604Open in IMG/M
3300014486|Ga0182004_10236191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor600Open in IMG/M
3300014486|Ga0182004_10237027All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei599Open in IMG/M
3300014486|Ga0182004_10239954All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei593Open in IMG/M
3300014486|Ga0182004_10241133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor591Open in IMG/M
3300014486|Ga0182004_10241375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor590Open in IMG/M
3300014486|Ga0182004_10242218All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor589Open in IMG/M
3300014486|Ga0182004_10246731All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor581Open in IMG/M
3300014486|Ga0182004_10247733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor579Open in IMG/M
3300014486|Ga0182004_10249031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei576Open in IMG/M
3300014486|Ga0182004_10253208All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei569Open in IMG/M
3300014486|Ga0182004_10254857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor566Open in IMG/M
3300014486|Ga0182004_10255699All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei565Open in IMG/M
3300014486|Ga0182004_10257484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor562Open in IMG/M
3300014486|Ga0182004_10259334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor559Open in IMG/M
3300014486|Ga0182004_10260828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor556Open in IMG/M
3300014486|Ga0182004_10263427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor552Open in IMG/M
3300014486|Ga0182004_10264768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor550Open in IMG/M
3300014486|Ga0182004_10270336All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae542Open in IMG/M
3300014486|Ga0182004_10272244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae539Open in IMG/M
3300014486|Ga0182004_10276204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor533Open in IMG/M
3300014486|Ga0182004_10278042All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor530Open in IMG/M
3300014486|Ga0182004_10279106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor529Open in IMG/M
3300014486|Ga0182004_10280653Not Available527Open in IMG/M
3300014486|Ga0182004_10285344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor520Open in IMG/M
3300014486|Ga0182004_10286356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei519Open in IMG/M
3300014486|Ga0182004_10291407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor513Open in IMG/M
3300014486|Ga0182004_10296361All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor507Open in IMG/M
3300014486|Ga0182004_10299170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor503Open in IMG/M
3300014486|Ga0182004_10299316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor503Open in IMG/M
3300014486|Ga0182004_10300920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor501Open in IMG/M
3300014969|Ga0157376_12016860Not Available615Open in IMG/M
3300015262|Ga0182007_10170203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor749Open in IMG/M
3300015262|Ga0182007_10281802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor605Open in IMG/M
3300015265|Ga0182005_1173455All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor637Open in IMG/M
3300015267|Ga0182122_1034686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor618Open in IMG/M
3300015268|Ga0182154_1022425All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei697Open in IMG/M
3300015268|Ga0182154_1074986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei500Open in IMG/M
3300015269|Ga0182113_1064049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius572Open in IMG/M
3300015269|Ga0182113_1093524All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei509Open in IMG/M
3300015276|Ga0182170_1039780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor611Open in IMG/M
3300015276|Ga0182170_1069189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor520Open in IMG/M
3300015277|Ga0182128_1024118Not Available705Open in IMG/M
3300015277|Ga0182128_1026609All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor686Open in IMG/M
3300015277|Ga0182128_1058775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor550Open in IMG/M
3300015279|Ga0182174_1003659All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1213Open in IMG/M
3300015279|Ga0182174_1042443All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae620Open in IMG/M
3300015279|Ga0182174_1043591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor615Open in IMG/M
3300015279|Ga0182174_1075582Not Available523Open in IMG/M
3300015281|Ga0182160_1027575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor690Open in IMG/M
3300015281|Ga0182160_1027791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor688Open in IMG/M
3300015281|Ga0182160_1070171All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor531Open in IMG/M
3300015283|Ga0182156_1051692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor590Open in IMG/M
3300015283|Ga0182156_1057448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor572Open in IMG/M
3300015283|Ga0182156_1059628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor565Open in IMG/M
3300015285|Ga0182186_1017211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor790Open in IMG/M
3300015286|Ga0182176_1024114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor747Open in IMG/M
3300015286|Ga0182176_1054469Not Available581Open in IMG/M
3300015286|Ga0182176_1072867All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei530Open in IMG/M
3300015287|Ga0182171_1048972All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor600Open in IMG/M
3300015287|Ga0182171_1057282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor573Open in IMG/M
3300015287|Ga0182171_1062649Not Available558Open in IMG/M
3300015288|Ga0182173_1021737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor743Open in IMG/M
3300015288|Ga0182173_1024879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor717Open in IMG/M
3300015292|Ga0182141_1044980All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei626Open in IMG/M
3300015294|Ga0182126_1025499All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei739Open in IMG/M
3300015295|Ga0182175_1016220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor846Open in IMG/M
3300015295|Ga0182175_1051057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor613Open in IMG/M
3300015295|Ga0182175_1078638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor539Open in IMG/M
3300015296|Ga0182157_1098100All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei511Open in IMG/M
3300015298|Ga0182106_1055537Not Available608Open in IMG/M
3300015300|Ga0182108_1065136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor586Open in IMG/M
3300015300|Ga0182108_1082531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei545Open in IMG/M
3300015303|Ga0182123_1043782All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei636Open in IMG/M
3300015303|Ga0182123_1081533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor533Open in IMG/M
3300015304|Ga0182112_1036533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor690Open in IMG/M
3300015304|Ga0182112_1062357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor591Open in IMG/M
3300015304|Ga0182112_1071302All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor568Open in IMG/M
3300015304|Ga0182112_1090429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor528Open in IMG/M
3300015305|Ga0182158_1009413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor997Open in IMG/M
3300015305|Ga0182158_1054520All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei612Open in IMG/M
3300015305|Ga0182158_1078795All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei549Open in IMG/M
3300015307|Ga0182144_1032756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor719Open in IMG/M
3300015307|Ga0182144_1044242Not Available659Open in IMG/M
3300015307|Ga0182144_1046744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta649Open in IMG/M
3300015308|Ga0182142_1008385Not Available1078Open in IMG/M
3300015308|Ga0182142_1116006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor502Open in IMG/M
3300015314|Ga0182140_1035395All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor719Open in IMG/M
3300015314|Ga0182140_1052086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor643Open in IMG/M
3300015314|Ga0182140_1055183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei633Open in IMG/M
3300015314|Ga0182140_1092699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor540Open in IMG/M
3300015321|Ga0182127_1118073Not Available511Open in IMG/M
3300015322|Ga0182110_1121194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor507Open in IMG/M
3300015323|Ga0182129_1016447All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor892Open in IMG/M
3300015323|Ga0182129_1040320Not Available690Open in IMG/M
3300015323|Ga0182129_1053973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum634Open in IMG/M
3300015326|Ga0182166_1051192All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei736Open in IMG/M
3300015339|Ga0182149_1124756All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei579Open in IMG/M
3300015340|Ga0182133_1037884All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor952Open in IMG/M
3300015341|Ga0182187_1144414All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei567Open in IMG/M
3300015342|Ga0182109_1029581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1038Open in IMG/M
3300015342|Ga0182109_1127054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor623Open in IMG/M
3300015342|Ga0182109_1193249All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor531Open in IMG/M
3300015342|Ga0182109_1200880All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei523Open in IMG/M
3300015343|Ga0182155_1010413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1387Open in IMG/M
3300015343|Ga0182155_1019888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1149Open in IMG/M
3300015343|Ga0182155_1120039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae634Open in IMG/M
3300015343|Ga0182155_1212372All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei513Open in IMG/M
3300015344|Ga0182189_1046054Not Available898Open in IMG/M
3300015344|Ga0182189_1149314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor592Open in IMG/M
3300015345|Ga0182111_1083443All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor757Open in IMG/M
3300015345|Ga0182111_1091924All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor731Open in IMG/M
3300015345|Ga0182111_1138020Not Available628Open in IMG/M
3300015345|Ga0182111_1224412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor520Open in IMG/M
3300015345|Ga0182111_1225089All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei519Open in IMG/M
3300015345|Ga0182111_1232367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor513Open in IMG/M
3300015346|Ga0182139_1057208Not Available868Open in IMG/M
3300015346|Ga0182139_1129780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor643Open in IMG/M
3300015346|Ga0182139_1183094All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei564Open in IMG/M
3300015346|Ga0182139_1209476Not Available535Open in IMG/M
3300015347|Ga0182177_1081419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor767Open in IMG/M
3300015347|Ga0182177_1158245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor599Open in IMG/M
3300015347|Ga0182177_1159272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor598Open in IMG/M
3300015347|Ga0182177_1174470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor577Open in IMG/M
3300015347|Ga0182177_1206155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor541Open in IMG/M
3300015347|Ga0182177_1224529All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei523Open in IMG/M
3300015347|Ga0182177_1244500Not Available505Open in IMG/M
3300015351|Ga0182161_1058542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor906Open in IMG/M
3300015351|Ga0182161_1118605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor694Open in IMG/M
3300015351|Ga0182161_1141429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor649Open in IMG/M
3300015355|Ga0182159_1140204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei747Open in IMG/M
3300015355|Ga0182159_1159590All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei707Open in IMG/M
3300015355|Ga0182159_1231531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor604Open in IMG/M
3300015361|Ga0182145_1118580All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei594Open in IMG/M
3300017407|Ga0182220_1079877Not Available549Open in IMG/M
3300017409|Ga0182204_1037136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor715Open in IMG/M
3300017410|Ga0182207_1005860All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1429Open in IMG/M
3300017410|Ga0182207_1008922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius1272Open in IMG/M
3300017410|Ga0182207_1069070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor688Open in IMG/M
3300017410|Ga0182207_1119544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei575Open in IMG/M
3300017410|Ga0182207_1177604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor501Open in IMG/M
3300017411|Ga0182208_1058539Not Available644Open in IMG/M
3300017411|Ga0182208_1068092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum615Open in IMG/M
3300017411|Ga0182208_1087243Not Available570Open in IMG/M
3300017413|Ga0182222_1005221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1090Open in IMG/M
3300017413|Ga0182222_1059337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor589Open in IMG/M
3300017413|Ga0182222_1066987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor570Open in IMG/M
3300017415|Ga0182202_1136214All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor506Open in IMG/M
3300017417|Ga0182230_1093097Not Available553Open in IMG/M
3300017417|Ga0182230_1100006All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei536Open in IMG/M
3300017424|Ga0182219_1001371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2807Open in IMG/M
3300017424|Ga0182219_1031466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor800Open in IMG/M
3300017425|Ga0182224_1060025All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei694Open in IMG/M
3300017425|Ga0182224_1086372All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei620Open in IMG/M
3300017427|Ga0182190_1129134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor548Open in IMG/M
3300017430|Ga0182192_1006979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1452Open in IMG/M
3300017430|Ga0182192_1099192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor611Open in IMG/M
3300017430|Ga0182192_1123126Not Available567Open in IMG/M
3300017430|Ga0182192_1128431All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei559Open in IMG/M
3300017430|Ga0182192_1165396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor510Open in IMG/M
3300017433|Ga0182206_1045651Not Available747Open in IMG/M
3300017433|Ga0182206_1106841Not Available572Open in IMG/M
3300017433|Ga0182206_1123443All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei546Open in IMG/M
3300017433|Ga0182206_1139001All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei525Open in IMG/M
3300017436|Ga0182209_1065012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor689Open in IMG/M
3300017436|Ga0182209_1087109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor629Open in IMG/M
3300017436|Ga0182209_1103544Not Available595Open in IMG/M
3300017436|Ga0182209_1147820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor530Open in IMG/M
3300017439|Ga0182200_1142188All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei530Open in IMG/M
3300017442|Ga0182221_1091412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor611Open in IMG/M
3300017442|Ga0182221_1095407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor603Open in IMG/M
3300017442|Ga0182221_1162636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor510Open in IMG/M
3300017443|Ga0182193_1016097Not Available1124Open in IMG/M
3300017443|Ga0182193_1057514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor762Open in IMG/M
3300017443|Ga0182193_1072552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor707Open in IMG/M
3300017443|Ga0182193_1141129All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei566Open in IMG/M
3300017680|Ga0182233_1071795Not Available622Open in IMG/M
3300017680|Ga0182233_1084223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor579Open in IMG/M
3300017682|Ga0182229_1036899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor838Open in IMG/M
3300017684|Ga0182225_1013318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1068Open in IMG/M
3300017684|Ga0182225_1034613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor783Open in IMG/M
3300017684|Ga0182225_1139004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis509Open in IMG/M
3300017685|Ga0182227_1087248All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei594Open in IMG/M
3300017686|Ga0182205_1030374Not Available886Open in IMG/M
3300017686|Ga0182205_1054973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor734Open in IMG/M
3300017689|Ga0182231_1109504All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta536Open in IMG/M
3300017690|Ga0182223_1007941Not Available1053Open in IMG/M
3300017690|Ga0182223_1056431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta627Open in IMG/M
3300017690|Ga0182223_1063618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor606Open in IMG/M
3300017693|Ga0182216_1053102All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei877Open in IMG/M
3300025899|Ga0207642_10121503All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1348Open in IMG/M
3300025899|Ga0207642_10170815All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei1176Open in IMG/M
3300025904|Ga0207647_10694932All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor555Open in IMG/M
3300026078|Ga0207702_11683443All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei627Open in IMG/M
3300026758|Ga0207559_101487All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei844Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
RootHost-Associated → Plants → Roots → Unclassified → Unclassified → Root64.73%
Miscanthus PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere30.46%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.40%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated0.40%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring0.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.20%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.20%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.20%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.20%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.20%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.20%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
20094390002_050719SEnvironmentalOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014486Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015267Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015268Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015269Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015276Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015277Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015279Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015281Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015283Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015285Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015286Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015287Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015288Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015292Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015294Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015295Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015296Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015298Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015300Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015303Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015304Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015305Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015307Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015308Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015314Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015321Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015322Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015323Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015341Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015342Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015343Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015344Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015345Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015346Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015347Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015351Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015355Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015361Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017404Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017407Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017409Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017410Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017411Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017413Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017415Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017417Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017424Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017425Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017427Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017430Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017433Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017436Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017442Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017443Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017680Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017682Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017684Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017685Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017686Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017689Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017690Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026758Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K4-12 (SPAdes)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BISONS_324982009439000Hot SpringMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA
NODE_049020943300000156Sugar Cane Bagasse Incubating BioreactorMRHDIDSYDQDGEDQDEAWLDGPVVKVKGKSRLRSEGPCDGEA*
Ga0065714_1004512513300005288Miscanthus RhizosphereMMKELXMHMRHDIESCDQGGEDQDKTWLDGPVASVKGKSKALE*
Ga0070672_10106311533300005543Miscanthus RhizosphereMRHDIESCDQGGEDQDMTWLDGPVASVKGKSEALE*
Ga0068861_10122594213300005719Switchgrass RhizosphereRHDIESCDQGGEDQDKTWLDGPVASVKGKLEALERWTAWR*
Ga0105244_1025668613300009036Miscanthus RhizosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKSKALE*
Ga0105131_11133613300009989Switchgrass AssociatedHMRHDMESCDQGRDDQDKAWLDGPVAMVKGNSRL*
Ga0105139_107971213300009995Switchgrass AssociatedHMRHDMELCDQSGEDQDKAWLDGPVAIVKGKSRL*
Ga0157374_1136230313300013296Miscanthus RhizosphereMRHDIESCDQGGEDQDMTWLDGPVASVKGKLEALERWTTWR*
Ga0157378_1291030523300013297Miscanthus RhizosphereMRHDIESCDQGGEDQDMTWLDGPVATVKGKLEALERWTAWQ*
Ga0182004_10000053373300014486RootMRHDIESCDQGGEDQDEAWLDGLVARVKGKSEALKRGTACDGEA*
Ga0182004_1000006523300014486RootMRHDMESCDQGREDQDEAWLNGPVARVKGKSEALKRGTVCDGEA*
Ga0182004_1000047713300014486RootMESCDQGGEDQDEAWLDGLIARVKGKSEALKRGTAC
Ga0182004_10000542173300014486RootMRHDMESCDQGGEYQDEAWLDRLVASVKGKSEALKRGTACDGEA*
Ga0182004_10000672203300014486RootMRHDMESCDQSGEDQDEAWLDGPVARVKGKSESLKRGTACDGEA*
Ga0182004_1000112353300014486RootMRHDMESCDHSGEDQDEAWLVGLVARVKDKLEALKRGTTCDSEA*
Ga0182004_1000114213300014486RootMRHDMESCDQGGEDQDEAWLDEPVARVKGKSKALKRGTACDGEA*
Ga0182004_1000133423300014486RootMRHDMKSCDQGGEDQDKTWLDEPVASVKDKSKVLK*
Ga0182004_10002054173300014486RootMRHDMESSNQGGEDQDEAWLDEPVASVKDKSEALKRGTACDGEA*
Ga0182004_1000224643300014486RootMRHDMESCDQGGEDQDGAWLDEPVARVKGKLKALKRGTACDGEA*
Ga0182004_1000236523300014486RootLHMRHDMESCDQGGEDQDETWLDGPVARVKSKSKALKRGTACDGEA*
Ga0182004_10002376103300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGITCDGEA*
Ga0182004_10002431133300014486RootMRHDMESCDQDGEDQDEAWLDGPVARVKGKLEALKRGTECDGEA*
Ga0182004_1000246723300014486RootLHMRHDMELCDQGREDQDEAWLDGPVTSVKGKSEALNQGTSCDGEA*
Ga0182004_1000277533300014486RootMESCDQGGEDQDRAWLNRPVARVKGKSEPLKQGTVCDGEA*
Ga0182004_1000291233300014486RootMRHDIESCDQGGEDQDEAWLDRPVASAKGKSEALK*
Ga0182004_10002914103300014486RootMRHDMQSCDQGGEDQDEAWLDGPVARVKGKSEALKQGTACDGET*
Ga0182004_1000321333300014486RootMESCDQGGEDQDETWLDGSVASVKGKSEALKRETACDGEA*
Ga0182004_1000333373300014486RootMRHAIESCDQGGEDQDEAWLDGPIASVKDKSEALKRGTTCDGEA*
Ga0182004_1000343823300014486RootMRHDMELCDQGGEDQDEASLDGSVARVKGKSEALKRGTACDDEA*
Ga0182004_10003593103300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKLEALKRGTACDGEP*
Ga0182004_1000378693300014486RootMMEELLHMGHDIGSCDQGGEDQDEAWLYGPVARVKGKSEALKRGTACDGEA*
Ga0182004_10004513113300014486RootMIEELIAYERHDKESCDQGGEDQDEAWLDGPIARVKGKSEALK*
Ga0182004_1000457553300014486RootMRHDMESCDLGGEDQDEAWLDGPVASMKDKLEAFK*
Ga0182004_1000461693300014486RootMRHDMESCDQGGEDQDKTWLDGPVVRVKGKSEALKRGTACDGEA*
Ga0182004_1000469223300014486RootMRHDLESCDQGGEDRDEAWLDGPVARVKDKSEAL*
Ga0182004_1000511083300014486RootMRHDMESCDQGGEDQVEAWLDGLVARVKGKLEALKRETTCDGEA*
Ga0182004_1000513513300014486RootMESYDQGEEDQDEAWLIRPVARVKGKLEALKQRTACDREA*
Ga0182004_1000547613300014486RootMRHDMESCDQGGEDKDEAWLDGPVARVKDKSEALKRGTACDGEA*
Ga0182004_10005557183300014486RootMRHDMESCDLGGEDQDEAWLDGPVARVKGKSEALKRGT
Ga0182004_10005808133300014486RootMRHDMESCHQGGEDQDETWLDGPVARVKGKSEALKRETACDGEA*
Ga0182004_1000592023300014486RootMRHDMESCDQGGEDQDEAWLDGLVARVRGKLEALKRGTACDGEA*
Ga0182004_10006033103300014486RootMHMRHDMESCDQGAEDQYEVWLDGLVTRVKGKSEALKRGTACDGEA*
Ga0182004_1000617823300014486RootMRHDMESCDQGGEDQDEAWLDGPVVRVKGKLEALKRGTACDYEA*
Ga0182004_1000618233300014486RootMRHYMESCDQGGEDQDEAWLDGPVARVKVKSEASKRGTACDGEA*
Ga0182004_1000618453300014486RootMKHNIESCDQGGEDQDEAWLDGPVASVKGKLEALK*
Ga0182004_1000628733300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALWRGTACDGEA*
Ga0182004_10006289103300014486RootMESCDQGGEDRDEAWLNGPVARVKGKSDALKRGTAYDGEA*
Ga0182004_1000657783300014486RootMRHDMESCDQGGEDQDEAWLNGPVARVKGKSEALK*
Ga0182004_1000696373300014486RootMRHDMESCDQGGEDQDEAWLNGPVARVKDKSEALKRGTACDGEA*
Ga0182004_10007064103300014486RootMRHDMESCDQGGEDQDEAWLNGLVASVMGKLEALKRGTACDGEA*
Ga0182004_1000712423300014486RootMRHDMESCGQGGEDQDEAWLDGPVVRVKGKSKALKRETTCDGEA*
Ga0182004_1000762983300014486RootMRHDMESCDQDGEDQDQASLDGLVTSVKGKSKALK*
Ga0182004_10007840103300014486RootMRHDMESCDKGGEDQDEAWIDGPVARVKGKSKALKRGTACDSEA*
Ga0182004_1000796243300014486RootMESCDQGVEDQDKSWLDGPVARVKDKSKALKRGTTWDGEA*
Ga0182004_1000836013300014486RootMESCDQGGEDQDEAWLDGLVARVKGKSEALKRGTACD
Ga0182004_1000871773300014486RootMRHDMESCDQGGEDQDKAWLDELVASVKGKSKVLK*
Ga0182004_1000872763300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKLKALKRGTACDGEA*
Ga0182004_1000873073300014486RootMRHDMNSCDQDGEDQDEAWLDGPLASVKEKSETLK*
Ga0182004_1000873873300014486RootMRYEMESCEHSGEDHDKAWLDGPVASVKHKSEALK*
Ga0182004_1000879713300014486RootMRHDMESCDQGGEDQDEAWLDRPVARVKGKSEALKLRTACDGEA*
Ga0182004_1000902323300014486RootLHTRHDMESCDQGGEDQDEAWLNGPVARVKGKSEALKLGTACDGEA*
Ga0182004_10009431123300014486RootMRHDMESCDQDGEDQDEAWLDGPVTRVKGKSEALKRGTACDGEA*
Ga0182004_1000996113300014486RootMESCDQGGEDQDEAWLDGPVARVMGKSEALKRGTACDGEA*
Ga0182004_1001033463300014486RootMESCDQGGEDQDEAWLDGPIARVKGKSEALKRETACDSEA*
Ga0182004_1001050673300014486RootMESCDQGGEDQDEAWFNGPVASVKGKSEALKRGTACDGEA*
Ga0182004_1001054963300014486RootMRHDMESCDQGGEDQDEAWLDEPITRVKGKSEALK*
Ga0182004_1001063613300014486RootMRHDMESCDRGGEDQDETWLDGSVARVKGKSKALKRGTACDGEA*
Ga0182004_1001068883300014486RootMRHDMKSCDQDGEDQDEACLDGPVASVKGKSKGFEARDCV*
Ga0182004_10011014103300014486RootMRHDIESCDQGGEDQDDAWLDGLVASVKGKSKALK*
Ga0182004_1001131483300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTAC
Ga0182004_1001184223300014486RootMESCDQGGEDQDEAWLDGPVARVKGKSKALKRGTACDGEA*
Ga0182004_1001187193300014486RootMELCDQGGEDQDGAWLDEPVPRVNGKSKALKQGTTCDGEA*
Ga0182004_1001242433300014486RootMRHDIESCDQGGEDQDEAWLGGLVASVKGRSEALKRRTACDGEA*
Ga0182004_1001331713300014486RootMESCDQGGEDQDEAWLDGLFASVKGKSEALKQGTACDGEA*
Ga0182004_1001359443300014486RootMTWSHVTKGGEDQDEAWLNGQVASVKGKLEALKRGTTCDGEA*
Ga0182004_1001413453300014486RootMRYDMESYDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDDEA*
Ga0182004_1001417013300014486RootMKHDMESCDQGGKDQYEAWLDGPVARVKCKSEALKRGTTCDGQA*
Ga0182004_1001442613300014486RootMRHDMESCDQGGEDEDEAWIDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1001442623300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGNSEALK*
Ga0182004_1001527353300014486RootMRHDMELCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1001534793300014486RootMRHDMESCDQGREYQDEAWLDGSVASVKSKSEALKRGTACVDKS*
Ga0182004_10015670103300014486RootMRHDMESCDQGGEDQDEVWLDGPVARVKGKSEALKRGTACD
Ga0182004_1001567313300014486RootMRHDMESCDQGGKDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1001576943300014486RootMKHDMESCDQGGEHQDEAWFDGPIACVKGKLEALK*
Ga0182004_1001591913300014486RootMESCDQGREDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1001662343300014486RootMESCDQGGEDQDEAWFDGPVARVKGKSEALKRGTTYDGDA*
Ga0182004_1001665823300014486RootMRHGKESCDQGGEHQDDDGLDGPIATMKGKSEALKRETACDGEA*
Ga0182004_1001685523300014486RootMKHDMESYDQGGEDQDEAWFDGLVARVKGQSEALTRGTACDGEA*
Ga0182004_1001724493300014486RootMIYDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1001739613300014486RootMRHNMESCDQGGEDQDEAWLDGLVASVKGKSEALK*
Ga0182004_1001808723300014486RootMRHDMESCDLGGEDQDGAWLDGPVARVKGKSEALKRGTARDGEA*
Ga0182004_1001866723300014486RootMRHDKESCDQGGEDQDEACLDGPVARVKSKLEALKRGTACDGEA*
Ga0182004_1001871433300014486RootMRHDMESCDRGGEDQDEAWLDGPVARVKGKSEALKRGTTCDGEA*
Ga0182004_1001921623300014486RootMRHDMESCDQGGEYQDEAWLDRPVARVKGKSQALKRGTACDGEA*
Ga0182004_1001962673300014486RootMESYDQGGEYQDEAWLDRLVASVKGKSEALKRGTACDDEA*
Ga0182004_1001970523300014486RootMRYEMESCDQGGEDQDEAWLDGPVARVKGKSQALKRGTACDGEA*
Ga0182004_1002013543300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVNGKSEALKRGTACDGES*
Ga0182004_1002019813300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSQALKRGTTCDGEA*
Ga0182004_1002035123300014486RootMRHDMESCDQGGEDQDEAWLDGPITSVKGKSEALE*
Ga0182004_1002077943300014486RootMRYDIETCDQGEEDQDKAWLDGPVISVKGKSEALKRGTTCDGEA*
Ga0182004_1002133413300014486RootMSHDMESCDQGGEDQDEAWLDGPVARVKGKSKALKRGTTCDGEA*
Ga0182004_1002179013300014486RootMRHDMESCDQGGEDHDETWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1002208363300014486RootMESCDQGGEDQDEAWLDEPVVRVKGKSKALKRGTACDGEA*
Ga0182004_1002228413300014486RootMESCDQGGQDQDEAWLDGPVARVKDKSEALKQGTACDGEA*
Ga0182004_1002265523300014486RootMESCDQGGEDPDEACLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1002280333300014486RootMRHDIESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1002380123300014486RootMIHDIESCDQGGEDQDEAWLDGLVASVKGKSEALKRGTACDGEA*
Ga0182004_1002535013300014486RootMRHDMESCGQGGEDQDEAWLDGPPVARVKGKSKALKREIACDGEA*
Ga0182004_1002539513300014486RootMRHDMESCDQGGEDQDEAWFDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1002648833300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALK*GT
Ga0182004_1002671933300014486RootMRNDMESCDQGGEDQDEAWLDGLVASVKGKSKALKQGTACDGVA*
Ga0182004_1002680413300014486RootMESCDQGGEDQDEAWLDGPVARVKGKLEALKRGTACD
Ga0182004_1002713313300014486RootMRHDMESCDQGGEDQDEAWLDGPVVRVKGKLEALKRGTACDGEA*
Ga0182004_1002713333300014486RootMRHDMESCDQGGEDQNEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1002760113300014486RootMRHDLEPCDQGEDQDEAWLDGPVAGVKGKSENSKRGTTCDGEA*
Ga0182004_1002781233300014486RootMRHVMKLYDQGGEDQDKAWLDRPVASVKGKLKALK*
Ga0182004_1002844743300014486RootMMEELIAQRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTTCDGEA*
Ga0182004_1002880633300014486RootMESCDQGGEHQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1002889243300014486RootMRHDMESCDQHGEDQDEAWLDGPVARVKGKFEALK*
Ga0182004_1002948633300014486RootMRHDMKSYDQGGEDQDEAWLDGLVARVKGKLEALKRGTACDGEA*
Ga0182004_1002961023300014486RootMRHDIESCDQGGEGQDEAWLDGPVGRVKGKLEALKQGIACDGEA*
Ga0182004_1002987413300014486RootMRHDMESYDQGGEDQDEAWLDGPVARVKGKSKALK*
Ga0182004_1003056023300014486RootMESCDQGGEDQDEAWLDGPVARVKDKSEALKQGTVCDGEA*
Ga0182004_1003095723300014486RootMRHDMESCDQGGEDQDEAWLDGPVARLKGKSEALKRGTTCDGKA*
Ga0182004_1003168023300014486RootLHLRHDMESCDQGGADHDEAWLDGPVARVKGKSEALKRGTVCDGEA*
Ga0182004_1003328823300014486RootLHMRHDMESCDQGEEDQYEAWLDGLVARVKGKSEALKRETVCDGEA*
Ga0182004_1003392713300014486RootMRHDIESCDQGGEDQDEACLDGLVASMKGKSEALKRRNACDGEA*
Ga0182004_1003509323300014486RootMRHDMKSCDQGGEDQDEAWLDEPVARVKGKSEALKRGTACDGEA*
Ga0182004_1003538733300014486RootMRHNMESCDQGGEDQDEAWLDGPVASVMGKSEALK*
Ga0182004_1003578443300014486RootMRHKMESCDQGREDQDEDWFDGPVACVKAKSETLKRETMSNGEA*
Ga0182004_1003697723300014486RootLHIRHDMESCDQGGEDQDEAWLDGPIARVKGKSEALKRGTTCDGEA*
Ga0182004_1003802663300014486RootMRHDMESRDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1003857933300014486RootMRHDMESCDQGREDQDEAWLDGPVARVKGKSEAFEARDRV*
Ga0182004_1003920143300014486RootMRHDMESCYQGGEDQDEAWLDGPVARVKGKSESLKRGTACDGEA*
Ga0182004_1003940413300014486RootMRNDMESCDQGGEDQDEAWLDGPVVRVKGKSEALKRETACDSEA*
Ga0182004_1003942543300014486RootMMKEPLHMGHDMESCDQGGEDQDEAWLDGPVARVKGKSKALKRGTACDGEA*
Ga0182004_1004030713300014486RootMESCDQGGEDKDEAWLDELVARVKDKSEALKRGTTCDGEA*
Ga0182004_1004177723300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKLEALKRGTACDGEV*
Ga0182004_1004181113300014486RootMRHHMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA
Ga0182004_1004224023300014486RootMKSWDQGGEDQDEAWLHEPVAGVKGKSKALKRGTACDGEA*
Ga0182004_1004268623300014486RootLRHDIESCDQGGEDQDEAWLDGLVASVKGKSEALKRGTACDGEA*
Ga0182004_1004275143300014486RootMRRDMDSCDQGGEDQDEAWFDEPVVRVKGKSKALKRGTVCDGEA*
Ga0182004_1004289543300014486RootMRHYMESCDQGGKDQDEAWLDGPVARVKGKSEALKRGTASDGEA*
Ga0182004_1004353943300014486RootLHIRHDMESCDQGGEDQDKAWLDIPVARVKGKSEALKRGTACDGEA*
Ga0182004_1004375913300014486RootMESCDRGGEDQDEAWLDGPVARVKGKSEALKRGTACDG
Ga0182004_1004403423300014486RootMRHDMESCDQDGEDQDEAWLDGPVARVKGKSKALKRGTTCDGEA*
Ga0182004_1004488323300014486RootMRHDMESCDQGGEDQDEAWLDGLVASVKGKSEALK*
Ga0182004_1004611143300014486RootMRHDMESCDQGGEDQDEAWLDGLVASVKDKLEALKRGTACDGEA*
Ga0182004_1004614643300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKTKALKRGTTCDSEA*
Ga0182004_1004676823300014486RootMRHDMESCDQGGEDQDETWLDGPVARVKGKSEVLKRGTACDGEA*
Ga0182004_1004754623300014486RootMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACD
Ga0182004_1004781633300014486RootMRHDMESCDQGGEVQDEAWLDGPVARVKGKSKALKRGTACDGEA*
Ga0182004_1004810723300014486RootMRHDMKSCDQGGEDHDEAWLDGRVASVKGKSEALKRGTTCDSEA*
Ga0182004_1004834113300014486RootVRHDMESCDQGGQDQDEAWLDGPVAIVKSKSEALKQGTACDGEA*
Ga0182004_1004959013300014486RootMESCDQGGEDQDEAWLDGPVARVKGKSETLKRGTT
Ga0182004_1004987133300014486RootMESYDQGGEDQDEVWLNGPVARVKDKSEALKRGTVCDGEA*
Ga0182004_1004995813300014486RootMELCDQGGEDQDEAWLDGPVARVKGKSKALKRGTACDGEA*
Ga0182004_1005022553300014486RootMRHDIESYDQGGEDQDEAWLDGLVARVKGKSEALKRGTTCDGEA*
Ga0182004_1005088133300014486RootMESCDQGGEDQDEAWLDGPVARVQGKLEALKRGTACDGEA*
Ga0182004_1005097823300014486RootMRHDMESCDQGGEDQDEAWHDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1005143613300014486RootMRHDMESCDQGREDQDDAWLDRPVVSVKGKSETLKQGTDNEA*
Ga0182004_1005182013300014486RootCDHGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1005226033300014486RootMRHDMESCDKGGEDQDGAWLDGPVARVKGKSKALKRGTACDGEA*
Ga0182004_1005247733300014486RootMESYDQGGEDQDETWLDGPVARVTGKSEALKQETACDGEA*
Ga0182004_1005249433300014486RootMELCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1005291223300014486RootMRHAMESCDQGGEDKDNTWLNGPVANVKGKSEALK*
Ga0182004_1005292343300014486RootMRHDMESCDQGGEDQDEAWLDRPVASVKGKSEALKRETACDGEA*
Ga0182004_1005362613300014486RootMRHDMESCDQGGEDQDEAWLDGLVARVKGKLEALKRGTACDGEA*
Ga0182004_1005415813300014486RootMRHDMESCEQGGEDQDEAWLDGPVARVKGKSEALK*
Ga0182004_1005514623300014486RootMRHDMESCDQGGEDQGEAWLDGLVARLKGKSEALKRGTKCDGEA*
Ga0182004_1005578413300014486RootMRYDMESCDQGGKDQDEAWLDGPVARVKGKLEALKRGTACDGEA*
Ga0182004_1005614113300014486RootLHIRHDMESCDQGGEDQDEAWLDGPVARVKGKLEALKRGTACDGKA*
Ga0182004_1005636023300014486RootMESCDQGGEDQDEAWLDGLVASVKDKLEALKRGTACDGEA*
Ga0182004_1005778723300014486RootMRHDMESCDQGGEDQDEAWLNGPVARVKGKSETLKRGTTCDSEA*
Ga0182004_1005778913300014486RootMESCDQGGEDQDEAWLDGPVARVKGKLEALKRGTVCD
Ga0182004_1005967413300014486RootMRHDIESCDQGGEDQDEAWLDGLVASVKGKSKALKRGTVCDGEA*
Ga0182004_1005994913300014486RootMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTAC
Ga0182004_1006001123300014486RootLHMRHDMESCDQGGEDQDEVWLDGPIARVKGKSEALKRGTACDGEA*
Ga0182004_1006022913300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKQGTTCDSEA*
Ga0182004_1006041413300014486RootMRHDMESCDQGGEDQDEAWLEGPVARVKGKSETLKQGTACDGET*
Ga0182004_1006059923300014486RootMESCDQGGEDQDEAWLDGPGARVKGKSEALKRGTACDGEA*
Ga0182004_1006108013300014486RootMRHDMESCDQGGEDQDEAWLDGPVVRVKGKWEALK*
Ga0182004_1006135813300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSKALKRGTVCDDEA*
Ga0182004_1006185413300014486RootMRHDIESCDQGGEDQDEAWLDGLVASVKGKSEALKRGTAYDGEA*
Ga0182004_1006306313300014486RootMRHDMESCDQGGEDQDDAWLDGPVARVKGKSEALKRETACDGEA*
Ga0182004_1006340043300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGMLEALKRGTTCDGEA*
Ga0182004_1006400223300014486RootMRHNMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1006465713300014486RootMRHDMESYDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGKA*
Ga0182004_1006513733300014486RootMESCDQGGEDQDEAWLDGPVARVKGKSKALKQGTACDSEA*
Ga0182004_1006549713300014486RootMRHDMESCDQGGEDQDEACLDGPVARVKGKLEALKRGTACDGEV*
Ga0182004_1006654023300014486RootMRHEMESCQGGEDQDKACLDGPVARVKGKSEILKRAIACDGES*
Ga0182004_1006655433300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKAKSEALKRGTACDDEA*
Ga0182004_1006762323300014486RootMRHDIESCDQGGEDQDEAWLDGLVARVKGKSEALKQGTTCDGEA*
Ga0182004_1006824713300014486RootMRHDIESCDQGGEDQDEAWLDGLVASVKGKSDALK*
Ga0182004_1006858123300014486RootMRHDIESCDQGGEDQDETWLDGPVARVKGKSKALKRGTACDGED*
Ga0182004_1006915213300014486RootMRHDMESCDQGGEDQDEASLDGPVARVKGKSEALKRGTVCDGEA*
Ga0182004_1006947923300014486RootMESFDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1006973523300014486RootMRHDMESCDQCGEDQDEAWLDGQVARVKGKSEALKRGTACDGEA*
Ga0182004_1006996513300014486RootMESCDQGGEYQDEAWLDGPVARVKGKSEALKGGTACDDEA*
Ga0182004_1007009113300014486RootMRHDMESCDQDGEDQDEAWLDGPVIRVKGKLEALKQGTACDGEA*
Ga0182004_1007030733300014486RootMRHDMESCDQGGEDQDEAWLDGPVARLKGKSKALKRGTACDGEA*
Ga0182004_1007172113300014486RootMRHDMESCDQGGEDQDQAWLDGPVARVKGKSEALK*
Ga0182004_1007233243300014486RootMRHDMESCDQGGEYQDEAWLDGPVARVKGKSKALKRGTACDGEA*
Ga0182004_1007239423300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACD
Ga0182004_1007499723300014486RootMRHDMESCDQGGDDQDEAWLDGPVVRVKGKSKALKRGTVYDGEA*
Ga0182004_1007722213300014486RootMRHDMESCDQGGEDQDKTWLDGPVARVKGKSEALKRGTSCDGEA*
Ga0182004_1007919813300014486RootLHIRHDMESCDQGGEDQDEAWLDGPVARVKGKLEALKRGTACDGEA*
Ga0182004_1007949323300014486RootMTWSHVDQGGEDQDEAWLDGPVARVKDKSEALKRGTACESEA*
Ga0182004_1008157413300014486RootMESYDQGGEDEDEAWLDEPVARVKGKSEALKRGTACDGEA*
Ga0182004_1008164933300014486RootMRHDMESCDQDGEDQDEAWLDGPVARVKGKSEALKRGTA
Ga0182004_1008210433300014486RootMRHDMESCDQGGEDQDEAWLDGPVATVKGKSEALKRGTACDGEA*
Ga0182004_1008240913300014486RootMESCDQGGKDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1008255023300014486RootMRHNMESCDQGGEDQDEACLDGPVVRVKGKSEALKRETACDSEA*
Ga0182004_1008411423300014486RootMRHDIESCDQGGEDQDEAWLDGPVARVKDKSEALKRGTACDGEA*
Ga0182004_1008480323300014486RootMRRDMESCDQGGEDQDEAWLDGLVASVKDKSEALK*
Ga0182004_1008521523300014486RootSSLHMRHDMESCDQGGEDQDEAWLDGLVARVKGKSEALKRATACDGEA*
Ga0182004_1008785523300014486RootSSLHMRHDMESCDQGGEDQDEAWLDGQVARVKGKSEALKRETACDGEA*
Ga0182004_1008802123300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRRTTCDGEA*
Ga0182004_1008833413300014486RootMESCDQGGEDQDEAWLDGLVASVKGKSEALKRGTTCDGEA*
Ga0182004_1008860013300014486RootMRHDIESCDQGGEDQDEAWLDGPVASMKGKSEALKQGTACDSEA*
Ga0182004_1008919613300014486RootMRHDVESCDQGGEDQDEAWLDGPVARVKGKSEALKRETACNGEA*
Ga0182004_1008941013300014486RootHMRHDMESCDQGGEDQDEAWLDGPVARVKGKSETLKRGTTCDGEA*
Ga0182004_1008946613300014486RootMRHDMESCDQGGEDQDEAWLDGPVASVKDKSEALKRGTACDGEA*
Ga0182004_1008979713300014486RootMRHDMESCDQGGEDQDEAWLDGPIARVKGKLEALKRGTACDGEV*
Ga0182004_1009141823300014486RootMRHDMELCDQGGEDQDEAWLDGPVARVNGKSKNLKRGTVC*
Ga0182004_1009181213300014486RootMRHDMESCNQGGEDQDEAWLDGPVARVKGKSEPLKRGTACDGEA*
Ga0182004_1009192023300014486RootWRSSLHMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALK*
Ga0182004_1009382113300014486RootQGGEDQDEAWLDGPVARVKGKSEALKRGTACDSEA*
Ga0182004_1009464613300014486RootPLHMRHDMESCDQGGEDQDKAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1009631513300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALK*
Ga0182004_1009727313300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKLEALR*
Ga0182004_1009883513300014486RootMRHDMESCDQDGEDLDKAWLDGLIACVKGKSEALKRETACDS*
Ga0182004_1009895613300014486RootMRHDMESCDQGGGDQDEAWLDGPVARVKGKSEALKRGTTCDGEA*
Ga0182004_1010068023300014486RootMESCDQVREDQEEAWLDGPDARVKGKSEALKRGTACDGEA*
Ga0182004_1010107223300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGESEALKRGTACDGEA*
Ga0182004_1010118413300014486RootMRHDMESYDQDGEDQDEAWLDRPVARVKGKSEALKRGTACDGEA*
Ga0182004_1010170813300014486RootMESCDQGGEDQDETWLDGPVARVKGKSEALKQGTACDGEA
Ga0182004_1010248813300014486RootMRHDMESYDQGGEDQDEAWLDGPVARVKGKSEAFKRGTACDGEA*
Ga0182004_1010307123300014486RootMRHDMESYDQGGEDQDEAWLDGPVARVKGKSKALKRGTASDGEA*
Ga0182004_1010313613300014486RootMIHDMESCDQGGEDQDEAWLDGPVVRVKGKSEVLKRETACDGEA*
Ga0182004_1010389113300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKVKSEALK*
Ga0182004_1010876633300014486RootMESCDQGGEDQDEAWLDGLVARVKGKSEALKRGTACDGEA*
Ga0182004_1010876713300014486RootMRHDTESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1010973413300014486RootMRNDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDG
Ga0182004_1011230613300014486RootMRHDMESYDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDSEA*
Ga0182004_1011517913300014486RootMRHDMESCDQVGEDQDEAWLDGPVARVKGKSEALKRVTACDGEA*
Ga0182004_1011582123300014486RootMRHDMESCDQGGEDQDEAWLDGPVVRVKGKSEALKRG
Ga0182004_1011761913300014486RootMRHDMESCDQGGEDQDEAWLDRPVARVKGKSEALKRGTACDGEA*
Ga0182004_1012086113300014486RootMIHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTAC
Ga0182004_1013156113300014486RootMRHDMESCDQCGEDQDEAWVDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1013450223300014486RootMRHDIESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDG
Ga0182004_1013537433300014486RootMRHDMESCDQGGEDRDEAWLDGPVARVKDKLEALKRGTACHGEA*
Ga0182004_1013569023300014486RootMRHDMESSDQGGEDQDEAWLDEPVARVKGKLEALKRGTACDGEV*
Ga0182004_1014169913300014486RootMRHDMESYDQGGEDQDEAWLDRPVARVKGKLEALKRGTACDGEA*
Ga0182004_1014283823300014486RootMRHDMESCDQGGEDQDEAWLDGPIARVKGKSEALKRGTTCDGEA*
Ga0182004_1014346413300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKLGTVCDGEA*
Ga0182004_1014477713300014486RootMRHDIESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTTCDGEA*
Ga0182004_1014604623300014486RootMRHDMESCDQGGEDQDEAWLDGPVVRVKGKSEALK*
Ga0182004_1014629013300014486RootMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1014780113300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKDKSEALKRGSACDSEA*
Ga0182004_1014839813300014486RootMRHDMESCDQGGEDQDEAWLDRPVARVKGKLEALK*
Ga0182004_1014910513300014486RootSLHMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRETACDGEA*
Ga0182004_1014990723300014486RootMRHDMESCDQRGEDQDEAWLDGPVASVKGMSEALKRGTACDGEA*
Ga0182004_1015129023300014486RootMRHDMESCDQGGEDQDEAWLNEPVPRVKGKSEALKRGTACDGEA*
Ga0182004_1015143913300014486RootMRHDMESCDQGGEDQDKAWLDGPVARVKGKSEALKRGTACD
Ga0182004_1015469233300014486RootMESCDQGGEDQDEAWLDGPVARGKGKSKALKRGTTCDGEA*
Ga0182004_1015587023300014486RootMRHDMESRDQGGEDQDEAWLNRPVTSVNGKSEALKRGTTCDG*
Ga0182004_1015648213300014486RootMRHDMKSCDQGGVDQDEAWLDGPVARVKGKSKALKRGTGCDGEA*
Ga0182004_1015694013300014486RootMRHDMESYDQGGEDQDEAWLDGPVPRVKGKSEALKRGTACDGEA*
Ga0182004_1015728113300014486RootMRHDMESCDQGGEDQEEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1015869923300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEP*
Ga0182004_1015956413300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKSKLEALKRGTACDGEA*
Ga0182004_1016144713300014486RootMRHDMVSCDQSGEDQDEAWLDGPVARVKGKSKALKRGTACDGEA*
Ga0182004_1016273213300014486RootMRHDMESCHQGGEDQDEAWLDEPVARVKGKSKGLKRGTTCDGEA*
Ga0182004_1016671413300014486RootMRHDMESCDQGREDQDEAWLDGPVERVKGKLEALKRGTACDGEA*
Ga0182004_1016713713300014486RootMRHDMESYDQGGEDQDEAWLDGPVARVKGKSEALKRGTACD
Ga0182004_1016803313300014486RootMRHDMESCDQGGEDQDEAWLHGRVARVKGKSEALKRVTACDGEA*
Ga0182004_1016818623300014486RootMRHDMESCDQGGEYQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1016968213300014486RootMRHDMESCDQGGEDQDKVWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1017572613300014486RootMRHDMESCDQGGEDQDKAWLDGPVTRVKGKSEALKRGTACDGEA*
Ga0182004_1017648523300014486RootMRHDMESCDQGGEDQYEAWLDGPVARVKGKSEALKR
Ga0182004_1017651013300014486RootMRHVMESCDQGGEDQDEAWLDGPIARVKGKSEALKQGTTCDGEA*
Ga0182004_1017982513300014486RootESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGKA*
Ga0182004_1018168223300014486RootMRHDMESCEQGGEDQDEAWLDGLVASVKGKSEALKRGTACDGEA*
Ga0182004_1018483613300014486RootMRHDMESCDQGGEDQDEAWLDGPVSRVKGKSEALKRGTACDGEA*
Ga0182004_1018621713300014486RootMESCDQGGEDQDEAWLNGPVARVKGKLKALKRGTACDDEA*
Ga0182004_1018848123300014486RootMRHDMESCDEGGEDQDEAWLDGPVARVKGKSKALKRGTACDGEA*
Ga0182004_1018901213300014486RootMRHDMESCDQGGEDQDEAWLEGPVARVKGKSEALKQGTTCDGEA*
Ga0182004_1019085313300014486RootMIHDMESCDQGGEDQDEAWLDGLVASVKSKSEAL*
Ga0182004_1019246113300014486RootMRHDVESCDHGGEDQDEALLDGSVVRMKDKSEALKRGTACDGEA*
Ga0182004_1019963323300014486RootMKHDMESCDQGGEDQDEAWLDGLVARVKGKSEALKRGTACDG
Ga0182004_1020186523300014486RootMRHDMESCDRGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1020332813300014486RootMRHDMESCDQSGEDQDEAWLDGPVARVKGKSEALKQGTACDGEA*ARLGAD
Ga0182004_1020509623300014486RootMRHDIESCDQGGEDQDVAWLDGPVARVKGKSQALKRGTACDGEA*
Ga0182004_1021012513300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRETACDGEA*
Ga0182004_1021237613300014486RootMRRDMESCDQGGEDQDEAWLDGPVVRVKGKSEDLK*
Ga0182004_1021244123300014486RootMRHDMESCDQGGEDQDEAWLDGPIARVKGKSEALKRGTACD
Ga0182004_1021317523300014486RootMRHEMQSCDQGGEDQEEAWLDGPVARVKGKSEALKRETACDGKA*
Ga0182004_1022635313300014486RootMRHDMESCDQCGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1022956013300014486RootMRHDMKSCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACVGEA*
Ga0182004_1022970823300014486RootMRHDMESCDQGGEDQDEACLDGPVARVKSKSEALKCGTACDGEA*
Ga0182004_1023413213300014486RootLHMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTVCDGEA*
Ga0182004_1023619113300014486RootMRHDMESCDQGGEDQDEAWLDGLVARVKDKSKALKRGTACDGEA*
Ga0182004_1023702713300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVNGKSEGFKRGTACDGEV*
Ga0182004_1023995413300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGRSKALKQGTACER*
Ga0182004_1024113323300014486RootHMRHDMESCDQGGEDQDEAWLDGLVASVKGKSEALKRGTVCDGEA*
Ga0182004_1024137513300014486RootMKHDMESCDQGGEDQDEAWLDGPVARVKGKTEDLKRGTACDGEA*
Ga0182004_1024221813300014486RootMRHDMESCDQDGEDQDEAWLDGPVARVKDKSEALKRETTCDGEA*
Ga0182004_1024673113300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSKALKRGTVCDGEA*
Ga0182004_1024773323300014486RootMESCDQGGEDQDEAWLDGPVVRVKGKSEALKRGTACDGEA*
Ga0182004_1024903113300014486RootMRHDMESCDQGGEDQDEAWLDGSVARMKGKSEALKRGTACDGEA*
Ga0182004_1025320813300014486RootMIHDMESCDQGGEEQDKAWLDGPDARVKGKSEALKRGTACDGEA*
Ga0182004_1025485713300014486RootMESCDQGGEDQDEAWLDGPVVRVKGKSEALKRGTAC
Ga0182004_1025569913300014486RootMRHDMESCDQGGKDQDVAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1025748413300014486RootMRHDMESCDQGGEDQDEAWLDGLVARVKGKSEALKRGTACNGKA*
Ga0182004_1025933413300014486RootMRHDMESCYQGGEDQDEAWLDGPVARVKGKSEALKRGTA*
Ga0182004_1026082813300014486RootMRHDMESCDQGGEDQDQAWLDGPVARVKGKSEALKRGTTCDGEA*
Ga0182004_1026342713300014486RootMRHDIESCDQGGEDQDEAWLDGPVARMKGKSEALKRGTACDGEA*
Ga0182004_1026476813300014486RootMESCDQAGEDQDEAWLDGLVASVKGKSEALKRGTACDGEA*
Ga0182004_1027033613300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGNSEALKRGTACDCEA*
Ga0182004_1027224413300014486RootMRHDMESCDQGGENQDEAWLDGPVARVKGKSEALKRGTTCDGEA*
Ga0182004_1027620413300014486RootMRHDMESCDQGGEDQDEVWLDGPVGRVKGKSEALKRGTACDGEA*
Ga0182004_1027804213300014486RootMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDSES*
Ga0182004_1027910613300014486RootHMRHDMESCDQGGEDQDEAWLDGPVARVKGKSEGLKQGTMCDGEA*
Ga0182004_1028065323300014486RootMRHDMESCDQGGEDQDEAWLDRLVARVKGKSEALKQGTACDGEA*
Ga0182004_1028534413300014486RootMRHYMESCDQGGEDQDEAWHDGPVARVKRKSEALKRGTACDGEA*
Ga0182004_1028635613300014486RootHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1029140723300014486RootMRHDMESCDQGGEVQDEAWLDGPIARVKGKSEALKRGTACDSEA*
Ga0182004_1029636113300014486RootMRHDMESCDQSREDQDEAWHDAPVARVKGKSEALKRGTACDGEA*
Ga0182004_1029917023300014486RootMRHDMESCDQGGEDHDEAWLDGLVARVKGKLEALKRGTVCDGEA*
Ga0182004_1029931613300014486RootSCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA*
Ga0182004_1030092013300014486RootMRHDMESCDQGGEDQDEAWLNGPVARVKGKSEALKRGTMCDGEA*
Ga0157376_1201686013300014969Miscanthus RhizosphereMRYDIESCDQGREDQDMTWLDGPVESVKGKLEALER*
Ga0182007_1017020313300015262RhizosphereMRHNMESCDQGGEDQDEAWLDGLVARVKDKSEALKRGTACDGEA*
Ga0182007_1028180213300015262RhizosphereMESCDQGGEDQDEAWLDGLVVSVKGKSEALKQGTACD
Ga0182005_117345523300015265RhizosphereMELCDQGREDQDEAWLDGPVTSVKGKSEALKRGTACDGEA*
Ga0182122_103468613300015267Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVTSVRGKLEALEQWTVWR*
Ga0182122_107333413300015267Miscanthus PhyllosphereMRHDMESCDQGGEDQDKTWLHGLVASVKGKLSDDLA*
Ga0182154_102242513300015268Miscanthus PhyllosphereMRHDIKSCDQGGEDQDKTWLDGPVASVKGKSEALERWTAWR*
Ga0182154_107498613300015268Miscanthus PhyllosphereMRHDIESCDQGGEDHDKAWLDGPVAKVKGKSKALEQWTAWR*
Ga0182113_106404913300015269Miscanthus PhyllosphereMRHNIESCDQGGEDQDKTWLDGPVASVKGKSEALERWT
Ga0182113_109352413300015269Miscanthus PhyllosphereMRHDIKSCDQGGEDQDKTWLDGPIASVKGKSEALE*
Ga0182170_103978013300015276Miscanthus PhyllosphereMRHDIESCDQGGEDQNKTWLDGPVASVKGKSEALERWTA
Ga0182170_106918913300015276Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLNGLVASMKGKSEALERWTAWQ*
Ga0182128_102411823300015277Miscanthus PhyllosphereMRHDIESCDQGGEDHDKTWLDGSVASVKGKSEALK*
Ga0182128_102660913300015277Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKLEALE
Ga0182128_105877513300015277Miscanthus PhyllosphereHDIEPCDQGREDLDKTWLDGPVVSVKGKSEALERWTA*
Ga0182174_100365933300015279Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGLVASVKGKLEALEQWIAWQ*
Ga0182174_104244313300015279Miscanthus PhyllosphereMKHDIESCDQGGGDQDMTSLDGLVASVKGKLEALERWTM*
Ga0182174_104359113300015279Miscanthus PhyllosphereMRHDIESYDQGGEDQDKTWLDGPVVSVKGKSEALE*
Ga0182174_107558213300015279Miscanthus PhyllosphereMRHDIESCDYGGEDRDKTWLDGLIASMKGKLEALKRWATWR*
Ga0182160_102757513300015281Miscanthus PhyllosphereMRHDIESCDQGGKDQDITWLDGPVASVKGKLEALKRWTAC*
Ga0182160_102779113300015281Miscanthus PhyllosphereMRYDIESCDQGGEDQDITWLDGPVASVKGKLEALER
Ga0182160_107017113300015281Miscanthus PhyllosphereMMMKELIVKRHDIESCDQGGEDQDITWLDGPVASVKGKLEALERWT
Ga0182156_105169213300015283Miscanthus PhyllosphereMESCDQGGEDQDMTWLDGPVASVKGKLKALERWTAW
Ga0182156_105744813300015283Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKSEALERWTA
Ga0182156_105962813300015283Miscanthus PhyllosphereLHIRHDIESCDQGGEDQDMTWLDGPVASVKGKLEALERWT
Ga0182186_101721113300015285Miscanthus PhyllosphereMRHGIESCDQGGEDQDMTWLDGPVASVKSKLEALEQWTVWR
Ga0182176_102411413300015286Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLNGLVVSVKGKSEALERWTVWR*
Ga0182176_105446923300015286Miscanthus PhyllosphereMHTRHDIESCDQGGEDQDKTWLDGSVANVKGKSKALEQWTVWR*
Ga0182176_107286723300015286Miscanthus PhyllosphereMRHDIWSCDQGEEDQNMTWLDGPVASVKGKLEALE*
Ga0182171_104897223300015287Miscanthus PhyllosphereMRHDIESCDQGGEDQNKTWLDGPVARVMGKSEALKRWTAWW*
Ga0182171_105728213300015287Miscanthus PhyllosphereMRHDMESCDQGGEDQDMTWLDGPVASVKGKSKALE*
Ga0182171_106264923300015287Miscanthus PhyllosphereMRHDKESCDQGGEEQDKTWLDGPVTRVKGKLKALE*
Ga0182173_102173713300015288Miscanthus PhyllosphereMHMRHDIESCDQGGEDQDKTWLDGPVTSVKGKSEALERWTA*
Ga0182173_102487913300015288Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASMKGKSEALERWTAW
Ga0182141_104498013300015292Miscanthus PhyllosphereMRHDIESCGQGGEDQDMTWIDGPVASVKGKLEALERWTVWQ*
Ga0182126_102549913300015294Miscanthus PhyllosphereMRHAIESCDQGREDQDMTWLDEPVASVKGELEALERWTMWR*
Ga0182175_101622023300015295Miscanthus PhyllosphereMRHDIESYDQGGEDQDMTWLDGSVASVKGKSEAVERWSAWR*
Ga0182175_105105713300015295Miscanthus PhyllosphereVRHDIESCDQGGEDQDKTWLDGPVASVKGKSEALERWT
Ga0182175_107863813300015295Miscanthus PhyllosphereMRHDIKSCDQAGEDQDMTWFDGPVASVKGKSEALERWTAWR*
Ga0182157_109810013300015296Miscanthus PhyllosphereMRQDIESCDQDGEDQDMTWLDEPVASVKGKLEALEQWTA*
Ga0182106_105553723300015298Miscanthus PhyllosphereMRHDIESCDQGGEDQNMTWLDGSVASMKGKLEALERWTTWW*
Ga0182108_106513613300015300Miscanthus PhyllosphereMNMRHDIESCDQGGEDQDKTWLDGPVASVKGKSKALE*
Ga0182108_108253123300015300Miscanthus PhyllosphereMRHDMESCDQGGEDQDMTWLDRSVVSVKGKSEALE*
Ga0182123_104378213300015303Miscanthus PhyllosphereMRHDIELCDQGGEYQDKTWLDGLVASVKGKSEALERWTTWR*
Ga0182123_108153323300015303Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVANVKGKSKALE*
Ga0182112_103653323300015304Miscanthus PhyllosphereMRHDIESCDQGGEDQDKAWLDGPVASVKDKLEALE*
Ga0182112_106235723300015304Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVANVKGKLEALERWTA*
Ga0182112_107130223300015304Miscanthus PhyllosphereMRHDMESCDQGGEDQDMTWLDRPVASVKGKLEALE*
Ga0182112_109042923300015304Miscanthus PhyllosphereMRHDIELCDQGEEDQDKTWLDGPVARVKGKLEALERWTVWR*
Ga0182158_100941323300015305Miscanthus PhyllosphereLQIRHAIESCDQGREDQDMTWLDGPVASVKGKSEALERWT
Ga0182158_105452013300015305Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKLEALE*
Ga0182158_107879513300015305Miscanthus PhyllosphereMRHDIESCDQDGEDQDMTWLDGPVASMKGKLEALERWTAWR*
Ga0182144_103275613300015307Miscanthus PhyllosphereMRHDIESCDQGGEDQDETWLDGPVASVKGKSEALE*
Ga0182144_104424213300015307Miscanthus PhyllosphereESCDQGGEDQDKTWLDGPDVSVKGKSEALEQWTAHY*
Ga0182144_104674413300015307Miscanthus PhyllosphereMRHNIESCDQDGEDQDKTWLDGPVASVKGKSKALERW
Ga0182142_100838513300015308Miscanthus PhyllosphereMRHDIKSCDQGGEDQDMTWFDRPVASVKGKSEALERWTAWR*
Ga0182142_111600613300015308Miscanthus PhyllosphereSSLNMRHDIESCDQGGEDQDKTWLDRPVASVKGKSEALER*
Ga0182140_103539513300015314Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWFDGPVASVKGKSEALE
Ga0182140_105208613300015314Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKSEALERWTT
Ga0182140_105518313300015314Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGTVASVKGKSKALE*
Ga0182140_109269913300015314Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGHVASVKGKLEALERWTAWR*
Ga0182127_111807323300015321Miscanthus PhyllosphereMRHDIESCDQVREDQDMTSLDGPVARVKGKSEALERWTAWR*
Ga0182110_112119413300015322Miscanthus PhyllosphereMRHDIKSCDQGGEDQNKTWLEGPVASVKGKSEALE*
Ga0182129_101644723300015323Miscanthus PhyllosphereMRHDIESYDQGGEDQDKTWLDGPVASVKGKSEALEQWT
Ga0182129_104032013300015323Miscanthus PhyllosphereMRHDMESCDHSGEDQDKTWLDGPVVSVKGKLSDDL
Ga0182129_105397313300015323Miscanthus PhyllosphereMRHGIESCDQGGEDQDMTWLDGPVAGVKGKLEALE*
Ga0182166_105119213300015326Switchgrass PhyllosphereMRHDMESCDQGGEDQDEAWLDRPVASVKGKSEALK*
Ga0182149_112475613300015339Switchgrass PhyllosphereMRHDIESCDQGGEDQDEAWLDRPVASVKGKSEALK*
Ga0182133_103788413300015340Switchgrass PhyllosphereMHMRHDIESCDQGGEDQDIIWLDGPIARVKGKSEALERWTAWR*
Ga0182187_114441413300015341Miscanthus PhyllosphereMRHDIKSCDQGVEDEDKTWLDGPVASMKGKSEGLE*
Ga0182109_102958113300015342Miscanthus PhyllosphereMKHDIESCDQGGEYQDKTWLDGPVASVKGKSEALERWTTWR
Ga0182109_112705423300015342Miscanthus PhyllosphereMRHDIESYDQGGEDQDKTWLDGPVASVKGKSEALKR*
Ga0182109_119324913300015342Miscanthus PhyllosphereMRHDIESCDQGGEDQDKPWLDGPIASVKGKSEALERWTTWR*
Ga0182109_120088023300015342Miscanthus PhyllosphereMRHDIESCDQGGEDQDKAWLDGPVANVKGKLEALERWTAWR*
Ga0182155_101041323300015343Miscanthus PhyllosphereMMMKELIVKRHDIESCDQGGEDQDITWLDGPVASVKGKLEALERWTAWR*
Ga0182155_101988823300015343Miscanthus PhyllosphereMRHDIESYDQGEKDQDKTWLDGLVARVKGKSEALERWTARR*
Ga0182155_112003913300015343Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVASVKGKLEALERWTAWR
Ga0182155_121237213300015343Miscanthus PhyllosphereDIESCDQGGEDQDITWLDGPVASMKGKLEALERWIAGR*
Ga0182189_104605413300015344Miscanthus PhyllosphereMRHDMESCDIGGEDQDKTWLDRLVASMKGKLEALE*
Ga0182189_114931413300015344Miscanthus PhyllosphereVRHDIESCDQGGEDQDKTWLDGPVASVKGKSEALE*
Ga0182111_108344313300015345Miscanthus PhyllosphereMRHDIKSCDQGGEDQDMTWLDGPVASVKGKLEALE*
Ga0182111_109192423300015345Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKLEALERWTTWR*
Ga0182111_113802023300015345Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGLVASMKGKSKALE
Ga0182111_122441223300015345Miscanthus PhyllosphereMRHDIESCDKGGEDQDKTWLDGPVASVKGKSEALERWTAWR*
Ga0182111_122508923300015345Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGLVASVNGKLEALERWSAWR*
Ga0182111_123236713300015345Miscanthus PhyllosphereMRHDIESCDQGGEDQDLTWLDGPVASVKGKLEALERWTAWR*
Ga0182139_105720813300015346Miscanthus PhyllosphereLHIKHDIESCDQGGEDQDKTSLDGPVASVKDNSKALE*WT
Ga0182139_112978013300015346Miscanthus PhyllosphereMHMRHDIESCDQVGEDQDKTWLDGPVASVKGKLEALERLTAWR*
Ga0182139_118309413300015346Miscanthus PhyllosphereIKSCDQGGEDQDKTWLDGPVASVKGKSEALEQWTVWR*
Ga0182139_120947623300015346Miscanthus PhyllosphereMRHNIESCDQGGEDQDKTWLDGSVASVKDKSEALE
Ga0182177_108141913300015347Miscanthus PhyllosphereMRHDIESYDQGGEDQDMTWLDGPVASMKGKLEALERWTAW
Ga0182177_115824513300015347Miscanthus PhyllosphereMKELIAIRHDIESCDQGGEDQDKAWLVGPVARVKGKSEALKHWTAWQDA*
Ga0182177_115927223300015347Miscanthus PhyllosphereMRHDIKSSDQGGEDQDKTWLDGPVTRVKDKSEALERWTAWR*
Ga0182177_117447013300015347Miscanthus PhyllosphereMKHDMESCDQGGEDQDMTWLDGPVASMNGKSEALERWTAW
Ga0182177_120615523300015347Miscanthus PhyllosphereMRYDIESCDQGGEDQDMTWLDGPVARVKGKLEALEQWTAWR*
Ga0182177_122452913300015347Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGQVASVKGKSEALEQWTTWR*
Ga0182177_124450023300015347Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTCLDGPVASVKGKLEALE*
Ga0182161_105854213300015351Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVASVKGKSEALE
Ga0182161_111860513300015351Miscanthus PhyllosphereMSSLHLRHDVESCDQGGEDQDMTWFDGPVASVKGKSEALERWT
Ga0182161_114142923300015351Miscanthus PhyllosphereMRDDIESCDQGGEDQDMTWLDGPVVSVKGKLEALERWTAWR*
Ga0182159_114020433300015355Miscanthus PhyllosphereMRHGIESCDQGGEDQDMTLLDGPVASVKGKSEALER*
Ga0182159_115959023300015355Miscanthus PhyllosphereLLHMRHDIESCDQGGEDQDKTWLDGPVASVKGKLEALERWTTWR*
Ga0182159_123153123300015355Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPIAGVKGKSEALV*
Ga0182145_111858013300015361Miscanthus PhyllosphereIESCDQGGEDQDMTWLDGPVASVKGKSEALKRWTTWR*
Ga0182203_108612813300017404Miscanthus PhyllosphereMSHDIESCDQGGEDQDITWLDGLVASVKGKLSDDLA
Ga0182220_107987713300017407Miscanthus PhyllosphereMRHDIESCDQGEEDQDKTWLDGPVASVKGKSKALE
Ga0182204_103713613300017409Miscanthus PhyllosphereMRQDIESCDQGGEDQDITWLDGPVASMKGKSEALERWTTW
Ga0182207_100586023300017410Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGLVASVKGKMKALERWTAWR
Ga0182207_100892223300017410Miscanthus PhyllosphereMRHDIESCDKGGEDQDMTSLKGPVANMKGKLEALERWTAWR
Ga0182207_106907023300017410Miscanthus PhyllosphereMRHDIESFDQGGEDEDMTWLDGPVASVKGKLEALELWTAWW
Ga0182207_111954413300017410Miscanthus PhyllosphereMRHDIESYDQGGEDQDKTWLDGPVVSVKGKLEALER
Ga0182207_117760423300017410Miscanthus PhyllosphereMRHDMESCDQGGEDQYITWLDGPVASMKGKSKALERWT
Ga0182208_105853913300017411Miscanthus PhyllosphereMRHDIESCDQGGEDQYMTWLDGPVASVKDKLEALERWTAWR
Ga0182208_106809223300017411Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKSEALEQWTAW
Ga0182208_108724313300017411Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGLVASVKGKSKALE
Ga0182222_100522113300017413Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGLVASVKGKSEALEQWTA
Ga0182222_105933723300017413Miscanthus PhyllosphereMRHDIESCDKGGEDQDKTWLDGPVASMKGKLEALERWT
Ga0182222_106698723300017413Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKLEALERWIAWR
Ga0182202_113621413300017415Miscanthus PhyllosphereMRHDMESCDQVGEDQDEAWLDGPVVSVKGKSEALK
Ga0182230_109309733300017417Miscanthus PhyllosphereMRHDIESCDQGGEAQDMTWLNGPVASVKGKLEALERWTAWR
Ga0182230_110000633300017417Miscanthus PhyllosphereLHMRHDIESCDQGGEDQDKTWLDGPVASVKGKLKALK
Ga0182219_100137113300017424Miscanthus PhyllosphereMRRDIESCDQGGEDQDMTWLVGPVASVNGKLEALE
Ga0182219_103146623300017424Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWFDGPVARVKGKSEALEQ
Ga0182224_106002523300017425Miscanthus PhyllosphereVRHDIESCDQGGEDQDKTWLDGPVESMKGKSKALE
Ga0182224_108637213300017425Miscanthus PhyllosphereMRHDTESCDQGGEDQDKTWLDGPVAGVKGKLEALEQWTNMIT
Ga0182190_112913423300017427Miscanthus PhyllosphereMRPDIESCDQGGEDQDITWLDGLVASVKGKLEALEQWTAWR
Ga0182192_100697923300017430Miscanthus PhyllosphereMRQDIESCDQGGEDQDMTWLDGPVASVKDKLEALERWTAWR
Ga0182192_109919213300017430Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVASVKGKLKALER
Ga0182192_112312613300017430Miscanthus PhyllosphereMHIRHDIESCDQGGEDQDKTWLDGLVASVKGKSKA
Ga0182192_112843113300017430Miscanthus PhyllosphereRHDIESCDQGGEDQDKTWLDGPVASVKGKSEALERWTTWR
Ga0182192_116539613300017430Miscanthus PhyllosphereMRYDIESCDQGGEDQDMTWLDGPVTRVKGKLEALERWTAWR
Ga0182206_104565123300017433Miscanthus PhyllosphereHMRHDIESCDQYGEDQDKTWLDGPVESVKGKSEALE
Ga0182206_110684113300017433Miscanthus PhyllosphereMDSCDYLGGEDQDEAWLDGLVTSVKDKSEALKCQTV
Ga0182206_112344313300017433Miscanthus PhyllosphereMRHDIESCDQGEEDQDMTWLDRPVASVKGKLEALERWTVWR
Ga0182206_113900113300017433Miscanthus PhyllosphereLHMRHDIESCDQGGEDQDKTWLDGLVASVKGKSEALERWTAWW
Ga0182209_106501213300017436Miscanthus PhyllosphereMTHDIESCDQGGEDQDKTWLDGPIASVKGKLEALER
Ga0182209_108710913300017436Miscanthus PhyllosphereMRHDIESCDQGGKDQDKTWLDGPVARVKGKSEALE
Ga0182209_110354413300017436Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPDVSVKGKSEALEQWTAHY
Ga0182209_114782023300017436Miscanthus PhyllosphereMRHDIESCDQGGEDQDMIWLDGPVGSMKGKLEALERWTVWR
Ga0182200_114218813300017439Switchgrass PhyllosphereMSHDMESCDQGGEDQDEAWLDRPVASVKGKSEALK
Ga0182221_109141223300017442Miscanthus PhyllosphereQMRHDIESCDQGGEDQDITWLDGPVASVKGKLEALERWTMWR
Ga0182221_109540713300017442Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVASMKGKSEALERWTAWR
Ga0182221_116263623300017442Miscanthus PhyllosphereMRHDIESCDQGGDDQDKTWLDRPVASMKGKLEALERWTAW
Ga0182193_101609713300017443Miscanthus PhyllosphereMRHDIKSCDQGGEDQDMTWFDRPVASVKGKSEALERWTAWR
Ga0182193_105751413300017443Miscanthus PhyllosphereMRHDIKSCDQGGEDQDKTWLDGPVASMKGKLEALEQWTVWR
Ga0182193_107255213300017443Miscanthus PhyllosphereMHMRHDIESCDQGGEDQDMTWLDGPVASVKGKLEALE
Ga0182193_114112913300017443Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVAGVKGKLEALE
Ga0182233_107179513300017680Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGLVASMKGKSKALE
Ga0182233_108422323300017680Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVTSVKDKSEALERWTTWR
Ga0182229_103689913300017682Miscanthus PhyllosphereIESCDQGGENQDITWLDGSVASVKGKLEALERWTMWQ
Ga0182225_101331813300017684Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLNGPVASVKGKSEALE
Ga0182225_103461313300017684Miscanthus PhyllosphereMRHDIESCDYGGEDQDKTWIDGPVASVKGKSETLK
Ga0182225_113900423300017684Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKLKALE
Ga0182227_108724813300017685Miscanthus PhyllosphereTHVMMKELIAHETCIESCDQGGEDQGMTWLDGPVSSVKGKLKALE
Ga0182205_103037413300017686Miscanthus PhyllosphereMRHDIGSCDYGVEDQDKAWLDGPVASVKGKLIDDL
Ga0182205_105497313300017686Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVASVKGKSKALER
Ga0182231_110950413300017689Miscanthus PhyllosphereMRHDIESCDQGGEDQDMTWLDGPVASVMGKLEALERWTAWR
Ga0182223_100794123300017690Miscanthus PhyllosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKLKALEQWTAWR
Ga0182223_105643123300017690Miscanthus PhyllosphereMRQDIESCDQGGEDQDMTWLDGPVASVKDKLEALE
Ga0182223_106361813300017690Miscanthus PhyllosphereSSLHMRHGIESCDKGGEDQDKTWLDGLVASVKGKLEALERWTAWR
Ga0182216_105310223300017693Switchgrass PhyllosphereMRHDMESCDQGGEDQDEAWLDRPVASVKGKSEALK
Ga0207642_1012150323300025899Miscanthus RhizosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKSEALERW
Ga0207642_1017081513300025899Miscanthus RhizosphereMRHDIESCDQGGEDQDKTWLDGPVASVKGKSKALE
Ga0207647_1069493213300025904Corn RhizosphereMHMRHDIESCDQGGEDQDKTWLDGPVASMKGKSEALE
Ga0207702_1168344333300026078Corn RhizosphereSLLHMRHDIESCDQGGEDQDKTWLDGPVASVKGKSKALE
Ga0207559_10148723300026758SoilMRHDIESCDQGGEDQDKTWLDGPVASVKGKSEALERWTAWR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.