| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000464 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053015 | Ga0030603 |
| Sample Name | Human stool microbial communities from NIH, USA - visit number 3 of subject 159753524 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 110017103 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076190 | Metagenome | 118 | Y |
| F090514 | Metagenome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C1430060 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| C1437748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1359 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C1430060 | C1430060__gene_146036 | F076190 | GSIIISAANAPTAASRVSGRVWSLVRITIPNDLKSVKIRVEKPQNNSLYPYFQREPL |
| C1437748 | C1437748__gene_149079 | F090514 | SSRMNLRIHALKKASRQRPGVKIAAARFFSILYYPFCAKRSSFFQQNVQPRGNFFANRPIFVYFADVLPRLTGANWFVILLTIVPAGSRTRAGSSLPLSPASNIFLKQTPRRGLPLAWNAGAGSFLFCG |
| ⦗Top⦘ |