NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000271

7000000271: Human stool microbial communities from NIH, USA - visit 1, subject 508703490



Overview

Basic Information
IMG/M Taxon OID7000000271 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052789 | Ga0030536
Sample NameHuman stool microbial communities from NIH, USA - visit 1, subject 508703490
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size106588434
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073656Metagenome120N
F076190Metagenome118Y
F092228Metagenome107N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C2487817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1229Open in IMG/M
C2518644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii4517Open in IMG/M
SRS053335_LANL_scaffold_23120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes962Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C2487817C2487817__gene_150735F073656MTMEQDQEQMQGALYVAVDDGNKIIAMERSRRGDEGFRALLDEFTDYAANCGAIPSVLFFDIRTTDAALLPRIEAAEHNYLLDPSTVTEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVAREDLRRCRAVETERGTVLFTQEPDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWTFVNPQHGENLYVSNGIRDLTGLQIIMQRGYGYLMQNAERYWNREFVFRSGFDNIERKYASDLSDEGRAAKREEQYNLAAYILDRKFPIRRRPSSEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDE
C2518644C2518644__gene_163196F092228MKKKCTLVLISVLTVACIVFAYLLFFYNPSFNMVYDSDTDSYFNNSYLSYNDGTLAAADYRKTKVTAYDSKNNSTVNLPSNGCLINDNLFYINGNKLCCLDTTTNTRKTIDTDCRSFVCNNEVIAYTKNDSVILKNSDTLENIGDIKFDNQIYYINISDGNLYIAERIFEDKTDEYGYSFKVGKQYIFKKYDLKSCKLLKSKNANYVNGIRYVTVCQDTFYFFCDETQTVNNVCLDKDVNYPTIQHPDVKFITSNNDCVYYISEKTESAIILKTVESPYNGIWKLEVGSNKPVKIADKCDCDELLATK
SRS053335_LANL_scaffold_23120SRS053335_LANL_scaffold_23120__gene_51178F076190TAASRVSGRVWSLVRITVPNDLKFVKIRVEKPQNNSLYPYFQREPL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.