3300030696: Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 3_T2E_ScyKB8 developmental time series (Eukaryote Community Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300030696
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128996 | Gp0213220 | Ga0187728
• Sample Name: Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 3_T2E_ScyKB8 developmental time series (Eukaryote Community Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 76777770
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales	1
All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Unclassified

Location Information

• Location: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 40.7982
  • Long. (^o): -77.8599
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010522	Metatranscriptome	302	N
F099485	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0187728_1019084	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales	799
Ga0187728_1071545	All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa	504

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0187728_1019084	Ga0187728_10190843	F099485	SPSDNQVVRNPVKAVSKSMSQKPLLSMEDLMGLTWVLFEERY
Ga0187728_1071545	Ga0187728_10715451	F010522	RLDGLLMSDEEVDEKIKEHFDEEGSYKPPHMSNFQSMTRRDVMMNVRIPPLGIEPPPFGEEQIREIEEKTTIKRENIEWLRKHWADDSIKPDAKNHKLIWDDVTEMHKKGVSFATINLWIDYWSGADLYLPQAIYNRSWARIDS