| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029415 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133112 | Gp0282520 | Ga0243378 |
| Sample Name | Human fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-6_Run5 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Zhejiang University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 161769457 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Hangzhou | |||||||
| Coordinates | Lat. (o) | 30.0 | Long. (o) | 120.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026489 | Metagenome | 197 | N |
| F081453 | Metagenome | 114 | N |
| F082887 | Metagenome / Metatranscriptome | 113 | Y |
| F089005 | Metagenome | 109 | N |
| F090514 | Metagenome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0243378_1001630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 13257 | Open in IMG/M |
| Ga0243378_1001676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 12826 | Open in IMG/M |
| Ga0243378_1005638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2901 | Open in IMG/M |
| Ga0243378_1009522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1820 | Open in IMG/M |
| Ga0243378_1036244 | Not Available | 630 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0243378_1001630 | Ga0243378_100163012 | F089005 | LTKSKQRSIIALALLRLATSNEESKQALKVRRTLKIEQRDNSKETRNDFEESSKNYSEMYTKKHQK |
| Ga0243378_1001676 | Ga0243378_100167612 | F026489 | SASDFDALEPRKRGCSPLLTPKRRAAPEKTEDSRLFGVKIF |
| Ga0243378_1005638 | Ga0243378_10056381 | F081453 | MSPFFLWIGENIIEKYISANPVYVTNIKAPEFAVKG |
| Ga0243378_1009522 | Ga0243378_10095223 | F090514 | MNLRIHALKKASRQRPGVKIAAARFFSILYYPFCAKRSSFFQQNVQPRGNFFANRPIFVYFADIPPRLTGAKWFVILLTIVPAGSRTRAGSSLPLIPASNIFLKQTPRRGLPLAWNAGAGSFLFCD |
| Ga0243378_1036244 | Ga0243378_10362442 | F082887 | MEKLKKIAKYTTNILAIISALIAGINAVDGITIPYAIQIVQIIAVIQGVIGTYLLGQKVVTNKEDK |
| ⦗Top⦘ |