3300029242: Sewage sludge microbial communities from sewage treatment plant in Sweden - SWESTP1 - Uppsala-primary/surplus 102

Overview

Basic Information

• IMG/M Taxon OID: 3300029242
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0127417 | Gp0192528 | Ga0168113
• Sample Name: Sewage sludge microbial communities from sewage treatment plant in Sweden - SWESTP1 - Uppsala-primary/surplus 102
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Gothenburg
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 131296493
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Sewage Microbial Communities From Wastewater Treatment Plant In Sweden
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Sweden
• Coordinates
  • Lat. (^o): 59.844519
  • Long. (^o): 17.659844
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041480	Metagenome	160	Y
F088774	Metagenome / Metatranscriptome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0168113_1029205	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	951
Ga0168113_1054851	All Organisms → cellular organisms → Bacteria	598

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0168113_1029205	Ga0168113_10292052	F041480	LGLKGAKQLLSMDAASSKIRFVAKKDIVFFIKTSGDVIDLTSYIKLYEFVPVGQKREVTVTTKEGMLNNKEEAIGRLISFSVKMISKDNYQIQLPEQLAAGEYGFVWVKNMELKEFTVFAFGIDWKSSD
Ga0168113_1054851	Ga0168113_10548512	F088774	VGHTVQADAKFLRRVLLGLVFLTLVTGGMAGLTTVQAKSEAAGRCVVLCQ