| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029200 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118575 | Gp0137470 | Ga0120082 |
| Sample Name | Biofilm microbial communities from University of Hong Kong - Biofilm |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hong Kong |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 66096889 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia | 1 |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Biofilm → Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002630 | Metagenome / Metatranscriptome | 542 | Y |
| F029893 | Metagenome / Metatranscriptome | 187 | Y |
| F039700 | Metagenome / Metatranscriptome | 163 | Y |
| F047326 | Metagenome / Metatranscriptome | 150 | Y |
| F053372 | Metagenome / Metatranscriptome | 141 | Y |
| F066929 | Metagenome / Metatranscriptome | 126 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0120082_1000920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia | 3730 | Open in IMG/M |
| Ga0120082_1002129 | Not Available | 2482 | Open in IMG/M |
| Ga0120082_1002551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2288 | Open in IMG/M |
| Ga0120082_1015705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 867 | Open in IMG/M |
| Ga0120082_1017215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
| Ga0120082_1025658 | Not Available | 628 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0120082_1000920 | Ga0120082_10009204 | F053372 | LIIQDRDGSLLKEPKPPRNSALSKPAYRVEIPASTLDEHSSLIERVIAFAFDTLGARHLDVRVREYE |
| Ga0120082_1002129 | Ga0120082_10021296 | F029893 | MPVMQDSVSVAANSVSANVVAGQLYEFVPTGTKVTLSCTGSATGLRATLIANIPVMNDQAINLQNRFPIIPDDIVFQGAVRACRLVLTARNTTGGALTFFWRIDVN |
| Ga0120082_1002551 | Ga0120082_10025511 | F047326 | DGRHGFDGALVGAVDVDQLDLCVADIVIDARPVFGDCGRGSVGTANG |
| Ga0120082_1015705 | Ga0120082_10157051 | F002630 | DAALRLRDVGLNALRADPLMDPIRDEPRFRALLQRLKFPD |
| Ga0120082_1017215 | Ga0120082_10172152 | F066929 | NSRRSAVELTQTYLENIERALMLNRVQISAKASPAAAGDGAMLDEIEKVSSAPLDYYDANKTSAMTRLLELMIIAERAVSDTSNRDELLKWGPGRLMPILEGPLKDNCVMKR |
| Ga0120082_1025658 | Ga0120082_10256582 | F039700 | MPLFEVAILEQPTKKEAEEGASEKLVFGPTAVVAPNQQSAAIAAVMDAKAPTNIDRNRMQVLVRPFA |
| ⦗Top⦘ |