| Basic Information | |
|---|---|
| Family ID | F047326 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GLDRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.33 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.333 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 21.33 |
| PF12146 | Hydrolase_4 | 14.00 |
| PF05198 | IF3_N | 5.33 |
| PF13622 | 4HBT_3 | 2.67 |
| PF12695 | Abhydrolase_5 | 2.00 |
| PF12680 | SnoaL_2 | 1.33 |
| PF13417 | GST_N_3 | 0.67 |
| PF13484 | Fer4_16 | 0.67 |
| PF00296 | Bac_luciferase | 0.67 |
| PF01872 | RibD_C | 0.67 |
| PF13646 | HEAT_2 | 0.67 |
| PF00561 | Abhydrolase_1 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 5.33 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.67 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.67 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.33 % |
| All Organisms | root | All Organisms | 30.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001081|JGI12662J13196_1006141 | Not Available | 962 | Open in IMG/M |
| 3300001661|JGI12053J15887_10018565 | All Organisms → cellular organisms → Bacteria | 3876 | Open in IMG/M |
| 3300001661|JGI12053J15887_10240300 | Not Available | 904 | Open in IMG/M |
| 3300001686|C688J18823_10031942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 3605 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100221219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1785 | Open in IMG/M |
| 3300004092|Ga0062389_104886482 | Not Available | 505 | Open in IMG/M |
| 3300004153|Ga0063455_100859014 | Not Available | 637 | Open in IMG/M |
| 3300005328|Ga0070676_11065092 | Not Available | 610 | Open in IMG/M |
| 3300005353|Ga0070669_101040661 | Not Available | 703 | Open in IMG/M |
| 3300005454|Ga0066687_10985504 | Not Available | 503 | Open in IMG/M |
| 3300005544|Ga0070686_101754726 | Not Available | 527 | Open in IMG/M |
| 3300005545|Ga0070695_100323304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1147 | Open in IMG/M |
| 3300005560|Ga0066670_10993800 | Not Available | 512 | Open in IMG/M |
| 3300005563|Ga0068855_100526719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1281 | Open in IMG/M |
| 3300005568|Ga0066703_10790346 | Not Available | 543 | Open in IMG/M |
| 3300005575|Ga0066702_10468126 | Not Available | 770 | Open in IMG/M |
| 3300005844|Ga0068862_100697076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 983 | Open in IMG/M |
| 3300005983|Ga0081540_1020479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 3975 | Open in IMG/M |
| 3300005983|Ga0081540_1198936 | Not Available | 731 | Open in IMG/M |
| 3300006163|Ga0070715_10729816 | Not Available | 594 | Open in IMG/M |
| 3300006163|Ga0070715_11063683 | Not Available | 507 | Open in IMG/M |
| 3300006176|Ga0070765_101977039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300006177|Ga0075362_10131552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1191 | Open in IMG/M |
| 3300006794|Ga0066658_10487553 | Not Available | 670 | Open in IMG/M |
| 3300006797|Ga0066659_10180538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1528 | Open in IMG/M |
| 3300006903|Ga0075426_10904485 | Not Available | 666 | Open in IMG/M |
| 3300007258|Ga0099793_10318073 | Not Available | 758 | Open in IMG/M |
| 3300007265|Ga0099794_10403977 | Not Available | 714 | Open in IMG/M |
| 3300009100|Ga0075418_10512247 | Not Available | 1289 | Open in IMG/M |
| 3300009101|Ga0105247_11453501 | Not Available | 557 | Open in IMG/M |
| 3300009101|Ga0105247_11845650 | Not Available | 504 | Open in IMG/M |
| 3300009174|Ga0105241_10870124 | Not Available | 835 | Open in IMG/M |
| 3300009176|Ga0105242_10272049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1535 | Open in IMG/M |
| 3300009500|Ga0116229_10199909 | Not Available | 1721 | Open in IMG/M |
| 3300010038|Ga0126315_10952260 | Not Available | 573 | Open in IMG/M |
| 3300010044|Ga0126310_10821225 | Not Available | 717 | Open in IMG/M |
| 3300010333|Ga0134080_10464700 | Not Available | 596 | Open in IMG/M |
| 3300010373|Ga0134128_11438486 | Not Available | 759 | Open in IMG/M |
| 3300010396|Ga0134126_12787973 | Not Available | 530 | Open in IMG/M |
| 3300010397|Ga0134124_10752254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 970 | Open in IMG/M |
| 3300010403|Ga0134123_13271703 | Not Available | 522 | Open in IMG/M |
| 3300010865|Ga0126346_1278764 | Not Available | 638 | Open in IMG/M |
| 3300011119|Ga0105246_10745828 | Not Available | 863 | Open in IMG/M |
| 3300011119|Ga0105246_12539433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300011270|Ga0137391_10275750 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300012004|Ga0120134_1052785 | Not Available | 708 | Open in IMG/M |
| 3300012199|Ga0137383_10943935 | Not Available | 630 | Open in IMG/M |
| 3300012208|Ga0137376_10479004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1080 | Open in IMG/M |
| 3300012209|Ga0137379_10925010 | Not Available | 777 | Open in IMG/M |
| 3300012212|Ga0150985_119091647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1658 | Open in IMG/M |
| 3300012212|Ga0150985_121535076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 909 | Open in IMG/M |
| 3300012896|Ga0157303_10313759 | Not Available | 506 | Open in IMG/M |
| 3300012925|Ga0137419_10647648 | Not Available | 853 | Open in IMG/M |
| 3300012943|Ga0164241_10641133 | Not Available | 769 | Open in IMG/M |
| 3300012944|Ga0137410_11845667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300012961|Ga0164302_11434553 | Not Available | 565 | Open in IMG/M |
| 3300013296|Ga0157374_10998720 | Not Available | 856 | Open in IMG/M |
| 3300013307|Ga0157372_11524518 | Not Available | 770 | Open in IMG/M |
| 3300014166|Ga0134079_10539769 | Not Available | 570 | Open in IMG/M |
| 3300014326|Ga0157380_13154661 | Not Available | 526 | Open in IMG/M |
| 3300014745|Ga0157377_10455129 | Not Available | 884 | Open in IMG/M |
| 3300015053|Ga0137405_1048712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. Root123D2 | 550 | Open in IMG/M |
| 3300015194|Ga0167666_1112190 | Not Available | 551 | Open in IMG/M |
| 3300015242|Ga0137412_10753019 | Not Available | 719 | Open in IMG/M |
| 3300015245|Ga0137409_10105251 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
| 3300015374|Ga0132255_105038072 | Not Available | 559 | Open in IMG/M |
| 3300017792|Ga0163161_11783958 | Not Available | 547 | Open in IMG/M |
| 3300018027|Ga0184605_10509441 | Not Available | 523 | Open in IMG/M |
| 3300018042|Ga0187871_10393792 | Not Available | 765 | Open in IMG/M |
| 3300018075|Ga0184632_10378372 | Not Available | 599 | Open in IMG/M |
| 3300018076|Ga0184609_10540554 | Not Available | 527 | Open in IMG/M |
| 3300018422|Ga0190265_11940321 | Not Available | 695 | Open in IMG/M |
| 3300018429|Ga0190272_11558145 | Not Available | 675 | Open in IMG/M |
| 3300019361|Ga0173482_10204910 | Not Available | 810 | Open in IMG/M |
| 3300019362|Ga0173479_10653788 | Not Available | 559 | Open in IMG/M |
| 3300019377|Ga0190264_10899734 | Not Available | 691 | Open in IMG/M |
| 3300019887|Ga0193729_1037833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2007 | Open in IMG/M |
| 3300019889|Ga0193743_1024659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3009 | Open in IMG/M |
| 3300020580|Ga0210403_10449032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1050 | Open in IMG/M |
| 3300020582|Ga0210395_10144105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1776 | Open in IMG/M |
| 3300021088|Ga0210404_10471155 | Not Available | 707 | Open in IMG/M |
| 3300021420|Ga0210394_11027114 | Not Available | 713 | Open in IMG/M |
| 3300021559|Ga0210409_10837471 | Not Available | 793 | Open in IMG/M |
| 3300022516|Ga0224542_1024650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 769 | Open in IMG/M |
| 3300022756|Ga0222622_10419104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 945 | Open in IMG/M |
| 3300022756|Ga0222622_10608076 | Not Available | 789 | Open in IMG/M |
| 3300022903|Ga0247774_1115089 | Not Available | 633 | Open in IMG/M |
| 3300023258|Ga0224535_1095375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300025664|Ga0208849_1038593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1491 | Open in IMG/M |
| 3300025899|Ga0207642_10300695 | Not Available | 930 | Open in IMG/M |
| 3300025913|Ga0207695_11098825 | Not Available | 675 | Open in IMG/M |
| 3300025916|Ga0207663_10669435 | Not Available | 820 | Open in IMG/M |
| 3300025920|Ga0207649_11577371 | Not Available | 520 | Open in IMG/M |
| 3300025923|Ga0207681_11112696 | Not Available | 663 | Open in IMG/M |
| 3300025931|Ga0207644_10810770 | Not Available | 783 | Open in IMG/M |
| 3300025931|Ga0207644_10860587 | Not Available | 759 | Open in IMG/M |
| 3300025936|Ga0207670_11333755 | Not Available | 609 | Open in IMG/M |
| 3300025942|Ga0207689_10641463 | Not Available | 894 | Open in IMG/M |
| 3300025949|Ga0207667_10413479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1373 | Open in IMG/M |
| 3300025961|Ga0207712_10988487 | Not Available | 746 | Open in IMG/M |
| 3300026121|Ga0207683_10435962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300026467|Ga0257154_1072744 | Not Available | 544 | Open in IMG/M |
| 3300026508|Ga0257161_1076301 | Not Available | 689 | Open in IMG/M |
| 3300026557|Ga0179587_10389606 | Not Available | 907 | Open in IMG/M |
| 3300027480|Ga0208993_1065151 | Not Available | 661 | Open in IMG/M |
| 3300027512|Ga0209179_1056364 | Not Available | 849 | Open in IMG/M |
| 3300027524|Ga0208998_1036308 | Not Available | 793 | Open in IMG/M |
| 3300027546|Ga0208984_1146953 | Not Available | 505 | Open in IMG/M |
| 3300027574|Ga0208982_1068850 | Not Available | 709 | Open in IMG/M |
| 3300027587|Ga0209220_1098684 | Not Available | 767 | Open in IMG/M |
| 3300027643|Ga0209076_1149937 | Not Available | 652 | Open in IMG/M |
| 3300027681|Ga0208991_1097661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300027894|Ga0209068_10441517 | Not Available | 746 | Open in IMG/M |
| 3300028047|Ga0209526_10048799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2981 | Open in IMG/M |
| 3300028380|Ga0268265_10538490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1106 | Open in IMG/M |
| 3300028380|Ga0268265_11225765 | Not Available | 748 | Open in IMG/M |
| 3300028592|Ga0247822_11034784 | Not Available | 679 | Open in IMG/M |
| 3300028673|Ga0257175_1066963 | Not Available | 676 | Open in IMG/M |
| 3300028708|Ga0307295_10177388 | Not Available | 599 | Open in IMG/M |
| 3300028709|Ga0307279_10055295 | Not Available | 658 | Open in IMG/M |
| 3300028712|Ga0307285_10013641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1789 | Open in IMG/M |
| 3300028719|Ga0307301_10254334 | Not Available | 574 | Open in IMG/M |
| 3300028778|Ga0307288_10288015 | Not Available | 651 | Open in IMG/M |
| 3300028790|Ga0307283_10152020 | Not Available | 639 | Open in IMG/M |
| 3300028875|Ga0307289_10395579 | Not Available | 568 | Open in IMG/M |
| 3300028881|Ga0307277_10107064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1190 | Open in IMG/M |
| 3300028885|Ga0307304_10333030 | Not Available | 676 | Open in IMG/M |
| 3300029200|Ga0120082_1002551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2288 | Open in IMG/M |
| 3300029923|Ga0311347_10434530 | Not Available | 799 | Open in IMG/M |
| 3300029943|Ga0311340_10114258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2930 | Open in IMG/M |
| 3300029944|Ga0311352_10593020 | Not Available | 886 | Open in IMG/M |
| 3300029951|Ga0311371_12178309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
| 3300029954|Ga0311331_10641412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 995 | Open in IMG/M |
| 3300029997|Ga0302302_1075965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1415 | Open in IMG/M |
| 3300030002|Ga0311350_11610599 | Not Available | 575 | Open in IMG/M |
| 3300030503|Ga0311370_12180096 | Not Available | 545 | Open in IMG/M |
| 3300030966|Ga0075383_11296527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. KY75 | 654 | Open in IMG/M |
| 3300031027|Ga0302308_10416486 | Not Available | 804 | Open in IMG/M |
| 3300031170|Ga0307498_10129813 | Not Available | 813 | Open in IMG/M |
| 3300031708|Ga0310686_104648031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2798 | Open in IMG/M |
| 3300031708|Ga0310686_114859117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| 3300031718|Ga0307474_10732594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300031824|Ga0307413_11298749 | Not Available | 636 | Open in IMG/M |
| 3300031852|Ga0307410_10132849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1831 | Open in IMG/M |
| 3300031911|Ga0307412_11850114 | Not Available | 556 | Open in IMG/M |
| 3300031995|Ga0307409_101515112 | Not Available | 698 | Open in IMG/M |
| 3300032074|Ga0308173_11080973 | Not Available | 747 | Open in IMG/M |
| 3300032126|Ga0307415_100252279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1434 | Open in IMG/M |
| 3300032205|Ga0307472_101064263 | Not Available | 763 | Open in IMG/M |
| 3300034156|Ga0370502_0266854 | Not Available | 548 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.33% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.33% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.33% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.33% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.33% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.33% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.67% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.67% |
| Biofilm | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Biofilm | 0.67% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.67% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.67% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.67% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.67% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.67% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015194 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022516 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022903 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6 | Environmental | Open in IMG/M |
| 3300023258 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34 | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029200 | Biofilm microbial communities from University of Hong Kong - Biofilm | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030966 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12662J13196_10061411 | 3300001081 | Forest Soil | MPAFEGHLYGGRCFDRAVVRAVLINQLNLCIADFIVGARPVFGGSGRGSVGTANG* |
| JGI12053J15887_100185651 | 3300001661 | Forest Soil | HRHLDGGDRFDIAVVQACLIDQLDFVVADFIIGARPVFGGSGRGSVGTANG* |
| JGI12053J15887_102403002 | 3300001661 | Forest Soil | MIDTVLIDQLDFVIADFIVGARPVFAGGGRGSVGTANG* |
| C688J18823_100319421 | 3300001686 | Soil | HGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG* |
| JGIcombinedJ26739_1002212191 | 3300002245 | Forest Soil | AVLIDQLNLCVADFIVGARPVFGGSGRGSVGTANG* |
| Ga0062389_1048864821 | 3300004092 | Bog Forest Soil | DGGDRFDIAVVQACLVDQLDLVVADFIVGARPVFGSSGRGSIGTANG* |
| Ga0063455_1008590142 | 3300004153 | Soil | LDKIHARIEGHLDGKGCFDGAVVQAGLIDQLDLGVADFIVGARPVFDGGGRGSVGTANG* |
| Ga0070676_110650921 | 3300005328 | Miscanthus Rhizosphere | RSMVEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG* |
| Ga0070669_1010406612 | 3300005353 | Switchgrass Rhizosphere | GLDRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG* |
| Ga0066687_109855042 | 3300005454 | Soil | HGLDGALVGAVGVDQLDLCIADIIIDARPVVGDGGRGSIGTANG* |
| Ga0070686_1017547261 | 3300005544 | Switchgrass Rhizosphere | GLDRSVVEAGLIDQLDLCVADFIVGARPVFGCGGRGSVGTANG* |
| Ga0070695_1003233042 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | IHARLEGHLDGDHGLDGSVVEAGLIDQLDLRVSDIIIGARPVFGCSGRGSVGTANG* |
| Ga0066670_109938001 | 3300005560 | Soil | SVVRTILIDQLDLRVADIIIGARPVFGGSGRGSVGTANG* |
| Ga0068855_1005267193 | 3300005563 | Corn Rhizosphere | DGAVVRAVLIDQLNGGVADFVIGARPVFGGSGRGSVGTANG* |
| Ga0066703_107903461 | 3300005568 | Soil | KVHAGFEGHLDGQHSFDRAVVEAGLIDQLDLRVADFIIGARPVFGCGGRGSVGTANG* |
| Ga0066702_104681262 | 3300005575 | Soil | GHLDGGDCLDRAVVRAVLVDQLNLCVADFIIGARPVFGGSGRGSVGTANG* |
| Ga0068862_1006970761 | 3300005844 | Switchgrass Rhizosphere | SVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG* |
| Ga0081540_10204796 | 3300005983 | Tabebuia Heterophylla Rhizosphere | CSVVGAVLIDQLDLRVADIIIGARPVFGCSGRGSVGTANG* |
| Ga0081540_11989362 | 3300005983 | Tabebuia Heterophylla Rhizosphere | LDGDHGLDRSVVGAVLIDQLDLRVADIVIGARPVFGCSGRGSVGTANG* |
| Ga0070715_107298161 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GLDRSMVGAVLIDQLDLRVADFIIGARPVFGCGGRGSVGTANG* |
| Ga0070715_110636831 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAVLIDQLNLCVADFIIGARPVFGGSGRGSIGTANG* |
| Ga0070765_1019770391 | 3300006176 | Soil | GRCFDRAVIQAVLVDQLNLCVADFIVGTRPVFGGSGRGSVGTANG* |
| Ga0075362_101315522 | 3300006177 | Populus Endosphere | AVLIDQLDLRVADFIIGARPVFGCGGRGSVGTANG* |
| Ga0066658_104875532 | 3300006794 | Soil | DGGDCLDRAVVRAVLVDQLNRGVADFVIGARPVFCGSGRGSVGTANG* |
| Ga0066659_101805381 | 3300006797 | Soil | HLYRRRRLDGAVIGTALIDQLDLCVADFVIGARPVFGGSGRGSVGTANG* |
| Ga0075426_109044851 | 3300006903 | Populus Rhizosphere | GHLDGDHGLDGSVVEAGLINQLDLRVSDFIIGARPVFGCSGRGSVGTANG* |
| Ga0099793_103180732 | 3300007258 | Vadose Zone Soil | AVVQACLIDQLDFVIADFIVGARPVFCGSGRGSVGTANG* |
| Ga0099794_104039771 | 3300007265 | Vadose Zone Soil | DIAVVQACLIDQLDFVVADFIIGAGPVFGGSGRGSVGTANG* |
| Ga0075418_105122471 | 3300009100 | Populus Rhizosphere | GNHGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG* |
| Ga0105247_114535012 | 3300009101 | Switchgrass Rhizosphere | VVETGLIDQLDLCIPDFIIGARPVFDCGGRGSVGTANG* |
| Ga0105247_118456502 | 3300009101 | Switchgrass Rhizosphere | LEGHLDGNNGLDRSVVEAGLIDQLDLCVADFIVGARPVFGCGGRGSVGTANG* |
| Ga0105241_108701242 | 3300009174 | Corn Rhizosphere | VVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG* |
| Ga0105242_102720493 | 3300009176 | Miscanthus Rhizosphere | FEGHLDGQHGFDGAVVEARLIDQLDLCVADFIIGARPVFGCGGRGSVGTANG* |
| Ga0116229_101999093 | 3300009500 | Host-Associated | MVQACLIDQLDFVIADFIVGARPVFGDSGRGSVGTANG* |
| Ga0126315_109522602 | 3300010038 | Serpentine Soil | NHGLDRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG* |
| Ga0126310_108212252 | 3300010044 | Serpentine Soil | LDRSVVEAGLIDQLDLRVADFIIGARPVFGCSGRGSVGTANG* |
| Ga0134080_104647001 | 3300010333 | Grasslands Soil | RFEGHLDGDHGFDGSVVRTILIDQLDLRVADIIIGARPVFGCSGRGSVGTANG* |
| Ga0134128_114384861 | 3300010373 | Terrestrial Soil | HLDGDHGLEGAVAYAGLIDKLDLGVADIIIGARPVFGCGGRGPVGTANG* |
| Ga0134126_127879732 | 3300010396 | Terrestrial Soil | DGHLDGKHRLDRSVVQTGLIDQLDLRVADFIIGARPVFYCGGRGSVGTANG* |
| Ga0134124_107522541 | 3300010397 | Terrestrial Soil | HLDSNRGLDRPVVEAGLIDQLDLCVSDFIIGARPVFGCSGRGSVGTANG* |
| Ga0134123_132717032 | 3300010403 | Terrestrial Soil | MVETGLIDQLDFVIADFIVGARPVFAGGGRGSVGTANG* |
| Ga0126346_12787642 | 3300010865 | Boreal Forest Soil | MIDARLIDQLDFVIADFIVGARPVFAGSGRGSVGTANG* |
| Ga0105246_107458281 | 3300011119 | Miscanthus Rhizosphere | ARFEGHLDGNHGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCGGRGSVGTANG* |
| Ga0105246_125394331 | 3300011119 | Miscanthus Rhizosphere | GLDRPVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG* |
| Ga0137391_102757503 | 3300011270 | Vadose Zone Soil | DGGDRFDIAVVQACLINQLDFVVADFIVGARPVFGGSGRGSVGTANG* |
| Ga0120134_10527851 | 3300012004 | Permafrost | GLDRAVVGAVLIDQLDLGVADIIVGARPVFGGGGRGSVGTANG* |
| Ga0137383_109439351 | 3300012199 | Vadose Zone Soil | DIAVVQACLIDQLDFVVADFIVGARPVFGGSGRGSVGTANG* |
| Ga0137376_104790041 | 3300012208 | Vadose Zone Soil | IHARLERHLDGNHGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG* |
| Ga0137379_109250101 | 3300012209 | Vadose Zone Soil | GHHGFDGAVVEARLIDQLDLRVADFIIGARPVFGCSGRGSVGTANG* |
| Ga0150985_1190916473 | 3300012212 | Avena Fatua Rhizosphere | LDRAVVRAALIDQLNRGVSDFIVGARPVFGGSGRGSVGTANG* |
| Ga0150985_1215350762 | 3300012212 | Avena Fatua Rhizosphere | MVDAGLIDQLDFVIADFIVGARPVFAGGGRGSVGTANG* |
| Ga0157303_103137592 | 3300012896 | Soil | DGNHGFNRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG* |
| Ga0137419_106476482 | 3300012925 | Vadose Zone Soil | GDRFDIAVVQACLIDQLDFVIADFIVGARPVFCGSGRGSVGTANG* |
| Ga0164241_106411332 | 3300012943 | Soil | EGHLDGDHGLNRSVVGAVLIDQLDLRVADIVIGARPVFGCSGRGSVGTANG* |
| Ga0137410_118456671 | 3300012944 | Vadose Zone Soil | VLIDQLNLCIADFIVCARPVFGGRGRGSVGTANG* |
| Ga0164302_114345532 | 3300012961 | Soil | RHRFDGAMVGTILVDQLDLCVADVVIDARPVFGDCGRGSIGTANG* |
| Ga0157374_109987201 | 3300013296 | Miscanthus Rhizosphere | IHARFEGHLDGNHGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCGGRGSVGTANG* |
| Ga0157372_115245182 | 3300013307 | Corn Rhizosphere | DGSVVEAGLIDQLDLRVSDIIIGARPVFGCSGRGSVGTANG* |
| Ga0134079_105397691 | 3300014166 | Grasslands Soil | LEGHLDGDHGFDCSVVEAGLIDQLDLRVADFIIGARPVFGCSGRGSVGTANG* |
| Ga0157380_131546612 | 3300014326 | Switchgrass Rhizosphere | GLIDQLDLRVADFIVGARPVFGCGGRGSVGTANG* |
| Ga0157377_104551292 | 3300014745 | Miscanthus Rhizosphere | VHGHLDGGHGLDGTMVGAILVDQLDLCVADVVIDARPVFGDCGRGSIGTANG* |
| Ga0137405_10487121 | 3300015053 | Vadose Zone Soil | GFHRHLDGGDRFDIAVVQACLINQLDFVVADFIVGARPVFGGSGRGSVGTANG* |
| Ga0167666_11121901 | 3300015194 | Glacier Forefield Soil | NLDKIHARFKGHLDGQHGFDRAVVETGLIDQLDLRVADFIIGARPVFGCGGRGSVGTANG |
| Ga0137412_107530191 | 3300015242 | Vadose Zone Soil | ALINQLDLRVADFIVVALPVFGCGGRGSVGTANG* |
| Ga0137409_101052511 | 3300015245 | Vadose Zone Soil | DEIHARFEGHLDGQHGFHGAVIEARLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG* |
| Ga0132255_1050380721 | 3300015374 | Arabidopsis Rhizosphere | GLDGALVGTIDVDQLDLCVADFIIDARPVFGDCGRGSVGTANG* |
| Ga0163161_117839582 | 3300017792 | Switchgrass Rhizosphere | DGNNGLDRSVVEAGLIDQLDLRVADFIVGARPVFGCGGRGSVGTANG |
| Ga0184605_105094411 | 3300018027 | Groundwater Sediment | IHARFEGHLDGNHGLDRSMVEAGLIDQLDLGVADFIIGARPVFGGSGRGSVGTANG |
| Ga0187871_103937921 | 3300018042 | Peatland | ACLVDQLDFVIADFIIGARPVFGGSGRGSVGTANG |
| Ga0184632_103783722 | 3300018075 | Groundwater Sediment | ARFEGHLDGNHGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCGGRGSVGTANG |
| Ga0184609_105405542 | 3300018076 | Groundwater Sediment | NLDKIHARFEGHLDGQHGFDSAVIEACLIDQLDLRVADIIIGARPVFGCSGRGSVGTANG |
| Ga0190265_119403212 | 3300018422 | Soil | GLDRSVVEAGLIDQLDLRVADFIIGARPVFGCSGRGSVGTANG |
| Ga0190272_115581452 | 3300018429 | Soil | DRAMVQAGLINQLDLCVADFIVGARPVFGGSGRGSVGTANG |
| Ga0173482_102049101 | 3300019361 | Soil | GNNGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG |
| Ga0173479_106537882 | 3300019362 | Soil | GTMVGAILVDQLDLCVADVVIDARPVFGDCGRGSIGTANG |
| Ga0190264_108997342 | 3300019377 | Soil | MVEAGLIDQLDLRVADFIIGARPVFGCSGRGSVGTANG |
| Ga0193729_10378334 | 3300019887 | Soil | MIDARLIDQLDFVIADFIVGARPVFAGSGRGSVGTANG |
| Ga0193743_10246595 | 3300019889 | Soil | FEGHLDGGNGFDRTVVEAGLINQLDLRVADFIVGARPVFGGSGRGSVGTANG |
| Ga0210403_104490321 | 3300020580 | Soil | RAVIQAVLVDQLNLCVADFIVGARPVFGGSGRGSVGTANG |
| Ga0210395_101441053 | 3300020582 | Soil | AVLIDQLNLCVADFIVGARPVFGGSGRGSVGTANG |
| Ga0210404_104711551 | 3300021088 | Soil | RAVLIDQLNLCVADFIVGARPVFGGSGRGSVGTANG |
| Ga0210394_110271141 | 3300021420 | Soil | DRAVVGAVLIDQLDLRVADIIVGARPVFGGGGRGSVGTANG |
| Ga0210409_108374712 | 3300021559 | Soil | GHGLDRAVVRAVLIDQLNLCVADFIVGARPVFGGSGRGSVGTANG |
| Ga0224542_10246502 | 3300022516 | Soil | AGLIDQLDGEIADFIIGARPVLCGGGRGSVGTANG |
| Ga0222622_104191042 | 3300022756 | Groundwater Sediment | HLDGDHGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG |
| Ga0222622_106080761 | 3300022756 | Groundwater Sediment | LDEIHARFEGHLDGNHGLDRSMVEAGLIDQLDLGVADFIIGARPVFGCGGRGSVGTANG |
| Ga0247774_11150892 | 3300022903 | Plant Litter | HARLERHFDGNDGLDRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Ga0224535_10953751 | 3300023258 | Soil | VDAGLIDQLDGEIADFIIGARPVLCGGGRGSVGTANG |
| Ga0208849_10385932 | 3300025664 | Arctic Peat Soil | LDGGDRFDIAVVEACLIDQLDFVVADFIVGARPVFGGSGRGSVGTANG |
| Ga0207642_103006952 | 3300025899 | Miscanthus Rhizosphere | IHAGFDSHLDGNHGLDRSVAEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Ga0207695_110988252 | 3300025913 | Corn Rhizosphere | AMVGAVLIDQLDLRVADIIVGARPVFGGGGRGSVGTANG |
| Ga0207663_106694352 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ARFEGHLDGYHGLDRSMVGAVLIDQLDLRVADFIIGARPVFGCGGRGSVGTANG |
| Ga0207649_115773712 | 3300025920 | Corn Rhizosphere | GDHGLDRSVVEAVLIDQLDLRVADIVIGARPVFGCSGRGSVGTANG |
| Ga0207681_111126962 | 3300025923 | Switchgrass Rhizosphere | RLEGHLDGDHGLDGSVVEAGLIDQLDLRVSDIIIGARPVFGCSGRGSVGTANG |
| Ga0207644_108107702 | 3300025931 | Switchgrass Rhizosphere | LDRSVVEAGLIDQLDLCVSDFIVGARPVFGCSGRGSVGTANG |
| Ga0207644_108605872 | 3300025931 | Switchgrass Rhizosphere | SMVEAGLIDQLDLCVADFIIGARPVFGCGGRGSVGTANG |
| Ga0207670_113337551 | 3300025936 | Switchgrass Rhizosphere | GNNGLDRSVVEAGLIDQLDLCVADFIVGARPVFGCGGRGSVGTANG |
| Ga0207689_106414632 | 3300025942 | Miscanthus Rhizosphere | KGHLDGNHGLDRPMVEAGLIDQLDLCVADFIIGARPVFGCGGRGSVGTANG |
| Ga0207667_104134791 | 3300025949 | Corn Rhizosphere | DGAVVRAVLIDQLNGGVADFVIGARPVFGGSGRGSVGTANG |
| Ga0207712_109884871 | 3300025961 | Switchgrass Rhizosphere | DEIHAGFDGHLDGNHGLDRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Ga0207683_104359621 | 3300026121 | Miscanthus Rhizosphere | RNLDEIHARLERHLDSNRGLDRPVVEAGLIDQLDLCVSDFIIGARPVFGCSGRGSVGTAN |
| Ga0257154_10727441 | 3300026467 | Soil | QAVLVDQLNLCVADFIVGARPVFGGSGRGSVGTANG |
| Ga0257161_10763012 | 3300026508 | Soil | VVQACLINQLDFVVADFIVGARPVFGGSGRGSVGTANG |
| Ga0179587_103896062 | 3300026557 | Vadose Zone Soil | GFEGHLYGGHCLDGAVVQTGLIDQLNLCVADFIVGARPVFGGSGRGSIGTANG |
| Ga0208993_10651512 | 3300027480 | Forest Soil | VVRAVLIDQLNLCVADFIVGARPVFCGSGRGSVGTANG |
| Ga0209179_10563641 | 3300027512 | Vadose Zone Soil | GDRFDIAVVQACLIDQLDFVIADFIVGARPVFCGSGRGSVGTANG |
| Ga0208998_10363082 | 3300027524 | Forest Soil | DGGHCLDRAVVQAGLIDQLNLCVADFIIGARPVFGGGGRGSVGTANG |
| Ga0208984_11469532 | 3300027546 | Forest Soil | QHGFDRAVIEAGLINQLDLRVADFIIGARPVFGRGGRGSVGTANG |
| Ga0208982_10688501 | 3300027574 | Forest Soil | GHCLDRAVVQPGLIDQLNLCVADFIIGARPVFGGGGRGSVGTANG |
| Ga0209220_10986842 | 3300027587 | Forest Soil | RLDRAVVKAVLVDQLNLCVADFIVGARPVFGGSGRGSVGTANG |
| Ga0209076_11499372 | 3300027643 | Vadose Zone Soil | AVVQACLIDQLDFVIADFIVGARPVFCGSGRGSVGTANG |
| Ga0208991_10976612 | 3300027681 | Forest Soil | MIDTVLIDQLDFVIADFIVGARPVFAGGGRGSVGTANG |
| Ga0209068_104415172 | 3300027894 | Watersheds | DGAVVGTVLIDQLDLRVADFIIGARPVFGCGGRGSVGTANG |
| Ga0209526_100487994 | 3300028047 | Forest Soil | DRAVVRAVLIDQLNLCVADFIVGARPVFGGSGRGSVGTANG |
| Ga0268265_105384901 | 3300028380 | Switchgrass Rhizosphere | PCLKRHLDGNHGFNRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Ga0268265_112257652 | 3300028380 | Switchgrass Rhizosphere | HGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCGGRGSVGTANG |
| Ga0247822_110347841 | 3300028592 | Soil | MVEAGLIDQLDLRVADFIIGARPVFGCGGRGSVGTANG |
| Ga0257175_10669632 | 3300028673 | Soil | GDRFYIAVVQACLIDQLDFVIADFIVGARPVFCGSGRGSVGTANG |
| Ga0307295_101773881 | 3300028708 | Soil | VHARVHGHLDGGHGLDGTMVGAILVDQLDLCVADVVIDARPVFGGLGRGSIGTANG |
| Ga0307279_100552952 | 3300028709 | Soil | CFDRAVVRAVLIDQLNLGVADFIVGARPVFGCSGRGSVGTANG |
| Ga0307285_100136413 | 3300028712 | Soil | RFEGHLDGNHGLDRSMVEAGLIDQLDLGVADFIIGARPVFGCGGRGSVGTANG |
| Ga0307301_102543342 | 3300028719 | Soil | LDEIHAGFDSHLDGNHGLDRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Ga0307288_102880151 | 3300028778 | Soil | RFEGHLDGNHGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG |
| Ga0307283_101520202 | 3300028790 | Soil | FHGAVIEARLIDQLDLRVADFIVGARPVFGCSGRGSVGTANG |
| Ga0307289_103955792 | 3300028875 | Soil | DRSMVEAGLIDQLDLGVADFIIGARPVFGCGGRGSVGTANG |
| Ga0307277_101070642 | 3300028881 | Soil | HLDGKHGLDRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Ga0307304_103330302 | 3300028885 | Soil | DGNHCLDRSMVEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG |
| Ga0120082_10025511 | 3300029200 | Biofilm | DGRHGFDGALVGAVDVDQLDLCVADIVIDARPVFGDCGRGSVGTANG |
| Ga0311347_104345302 | 3300029923 | Fen | ACLIDQLDFVIADFIVGARPVFGGSGRGSVGTANG |
| Ga0311340_101142581 | 3300029943 | Palsa | VVQACLIDQLDFVVADFIVGARPVFGGSGRGSVGTANG |
| Ga0311352_105930201 | 3300029944 | Palsa | GHLDGGHCLDRTVVRAVLVDQLNLCVADLIVGARPVFGGSGRGSIGTANG |
| Ga0311371_121783092 | 3300029951 | Palsa | SAMVEACLVDQLYFVIADFIVGARPVFGGSGRGSVGTANG |
| Ga0311331_106414122 | 3300029954 | Bog | VQACLVDQLDFVIADFIIGARPVFGGSGRGSVGTANG |
| Ga0302302_10759653 | 3300029997 | Palsa | QIHAGLGGHLDGGHGLDGAVIQAGLVDQLDLCVADFIVGARPVFGGGGRGSVGTANG |
| Ga0311350_116105991 | 3300030002 | Fen | SVVEAGLIDQLDLCVSDFIIGARPVFGCSGRGSVGTANG |
| Ga0311370_121800961 | 3300030503 | Palsa | EGHLDGGHCLDRTVVRAVLVDQLNLCVADLIVGARPVFGGSGRGSIGTANG |
| Ga0075383_112965272 | 3300030966 | Soil | MVLAVLINQLDFVVADFIVGARPVFGGSGRGSVGTANG |
| Ga0302308_104164861 | 3300031027 | Palsa | GFHRHLDGGDRLDIAVVQACLIDQLDFVVADFIVGARPVFGGSGRGSVGTANG |
| Ga0307498_101298131 | 3300031170 | Soil | GHLDGNHGLDRSMVEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG |
| Ga0310686_1046480311 | 3300031708 | Soil | ACLIDQLDFVIADFIVGARPVFGSSGRGSVGTANG |
| Ga0310686_1148591171 | 3300031708 | Soil | ACLIDQLDFVIADFIVGARPVFGGGGRGSVGTANG |
| Ga0307474_107325941 | 3300031718 | Hardwood Forest Soil | DIAVIDAGLIDQLDFVIADFIVGARPVFGGSGRGSVGTANG |
| Ga0307413_112987492 | 3300031824 | Rhizosphere | DRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Ga0307410_101328493 | 3300031852 | Rhizosphere | SVVEAGLIDQLDLRIADIIIGARPVFGCSGRGSVGTANG |
| Ga0307412_118501142 | 3300031911 | Rhizosphere | LDGNHGLDRSMIEAGLIDQLDLCVADFIIGARPVFGCSGRGSVGTANG |
| Ga0307409_1015151122 | 3300031995 | Rhizosphere | GLDRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Ga0308173_110809731 | 3300032074 | Soil | AVLIDQLNGGVADFVIGARPVFGGSGRGSVGTANG |
| Ga0307415_1002522791 | 3300032126 | Rhizosphere | NLDEIHARLKRHLDGNHGFNRSVVEAGLIDQLDLCVADFIVGARPVFGCSGRGSVGTANG |
| Ga0307472_1010642632 | 3300032205 | Hardwood Forest Soil | DGHHGLDRSMVGAVLIDQLDLRVADFIIGARPVFGCGGRGSVGTANG |
| Ga0370502_0266854_3_137 | 3300034156 | Untreated Peat Soil | NRLDLAEVDAGLIDQLDLVVANFIVGARPILSGGGRGSVGTANG |
| ⦗Top⦘ |