3300029082: Human fecal microbial communities from infant at 12 months in Denmark - 184_12M

Overview

Basic Information

• IMG/M Taxon OID: 3300029082
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0127429 | Gp0193539 | Ga0169230
• Sample Name: Human fecal microbial communities from infant at 12 months in Denmark - 184_12M
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 108879617
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Denmark
• Coordinates
  • Lat. (^o): 55.676097
  • Long. (^o): 12.568337
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076189	Metagenome	118	N
F081453	Metagenome	114	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0169230_100177	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis	38525
Ga0169230_107088	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	2669

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0169230_100177	Ga0169230_10017718	F081453	MYPFFLLAGDNIIEKHISANPVCGTNIRAPELAVKGAPGRKCIQ
Ga0169230_107088	Ga0169230_1070883	F076189	VLSAGHCFFLSPFIKPLLYVEKLQIGTVLPVVSDLYREFAELSVYFDLRAIQSAQKQLRMLCNFHENTFWLLIFYANYAIL