3300027653: Agricultural soil microbial communities from Georgia to study Nitrogen management - Poultry litter 2012 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300027653
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114436 | Gp0119790 | Ga0209487
• Sample Name: Agricultural soil microbial communities from Georgia to study Nitrogen management - Poultry litter 2012 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 542634336
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → agricultural field → poultry litter
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Georgia
• Coordinates
  • Lat. (^o): 33.8834
  • Long. (^o): -83.4195
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036417	Metagenome / Metatranscriptome	170	Y
F098955	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0209487_1000015	All Organisms → cellular organisms → Bacteria	203625
Ga0209487_1000127	All Organisms → cellular organisms → Bacteria	69491

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209487_1000015	Ga0209487_100001519	F036417	MAVYTRLTLRSLIPTVIVRLITDDGEITFRARWKDSALDLQRNILFRLRQGSPLIFEDEWGRTISFPAERISGAMVDGR
Ga0209487_1000127	Ga0209487_100012734	F098955	MDPSAIPVFLAGPFPVLHTARVSEIDAEVELDIGLLIGGLPTILAATAFPLDETWERVDAALASGDARLGVAGTMYEEESIVGTFDVVPTAYVGLECANGERLILAHIKSPDPDADPERYAHDVMTALLNGQTPADLGQLIEE