3300027414: Polar desert microbial communities from Antarctic Dry Valleys - UQ493 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300027414
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053075 | Gp0060306 | Ga0208493
• Sample Name: Polar desert microbial communities from Antarctic Dry Valleys - UQ493 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 20692400
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Polar Desert Microbial Communities From Antarctic Dry Valleys
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): polar desert biome → desert → ice
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Antarctic Dry Valleys
• Coordinates
  • Lat. (^o): -78.0836
  • Long. (^o): 164.2839
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208493_10409	Not Available	562

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208493_10409	Ga0208493_104091	F077438	YSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN