NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027405

3300027405: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A1-12 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027405 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0055675 | Ga0207464
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A1-12 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10576021
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.2958Long. (o)-89.3799Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020927Metagenome / Metatranscriptome221N
F034564Metagenome / Metatranscriptome174Y
F040803Metagenome / Metatranscriptome161Y
F084687Metagenome / Metatranscriptome112Y
F087420Metagenome / Metatranscriptome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207464_100095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales893Open in IMG/M
Ga0207464_100265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium730Open in IMG/M
Ga0207464_101662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
Ga0207464_101713Not Available507Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207464_100095Ga0207464_1000952F034564VCIAGLGFGLVGERRPFGENILAHPFIVYAFVLAAGLLVIRVVGQRPVPELIPERALGLGCAAGVALFLAGNFIAAHLIGR
Ga0207464_100106Ga0207464_1001062F084687MKLVRYRSASGEKPGLILDGEIFDLSGSFEALNPRAPTLDDIEAIAAVPAKALVKVEKGVVL
Ga0207464_100265Ga0207464_1002651F087420MEPTLGIRAKRSAAGGAIVLVLCALPHAPASAAKPPYAGCVVVTKQEYDSAKKQHMLQTRYTQYVRTGLPGRRQYWYCR
Ga0207464_101662Ga0207464_1016621F040803MELLIAVGFFGLISALVYFVLASKAPIADEAIQRRLQNIGFQNEARTQIRLHETEEITFWEQVSNFFFGDRELPERFNNAARRLHQAGYRGNRAVRIYWGLRIFLCLAFGFG
Ga0207464_101713Ga0207464_1017131F020927MWAAFVRQFAAYAITRRGKKLFALIGVLALCFGAALLIDMQFYVSASFAALLAGFAAVTYVVQHVKLKRAEHQRLLRKAEAAHQRALAAQARLERIDTAKSALRGAVTGAGRLVTDNVSIVANEALLMANETADTIT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.