Basic Information | |
---|---|
IMG/M Taxon OID | 3300026796 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053064 | Gp0104120 | Ga0208943 |
Sample Name | Rhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 19739258 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 3 |
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Rhizosphere → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | forest biome → rhizosphere → soil |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Harvard Forest, Massachusetts, USA | |||||||
Coordinates | Lat. (o) | 42.5502 | Long. (o) | -72.1737 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005160 | Metagenome / Metatranscriptome | 410 | Y |
F020351 | Metagenome / Metatranscriptome | 224 | Y |
F021008 | Metagenome / Metatranscriptome | 221 | Y |
F077438 | Metagenome / Metatranscriptome | 117 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0208943_100287 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
Ga0208943_100759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 542 | Open in IMG/M |
Ga0208943_100886 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
Ga0208943_100901 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0208943_100287 | Ga0208943_1002872 | F005160 | VPPASAILRLLVFAVPSARAAAGVQPLLGAATGVVQLRWALGLTAPAVVVAGLVFGAGRLFDRGDALQPPWYSAWVLFPGAFLLAGAAAMCIFGALTELSLIPPAMWTFLIAGSVLWAGAIVVVRSASR |
Ga0208943_100759 | Ga0208943_1007592 | F020351 | MTEMVTSGSMSGERKRSDGLLGESDYERRRLLQAPPVLPATALLLDSTQLLVR |
Ga0208943_100886 | Ga0208943_1008862 | F077438 | VYSTHRVEGSFTQSRLETLFLWNLQVEISSALRPKAEKEISSYKK |
Ga0208943_100901 | Ga0208943_1009011 | F021008 | MTNAPSMKLLGLDHIGIVVRDIDETVSRARETVDGRPVGERFVAADIDLQALLCGESTLELIEV |
⦗Top⦘ |