| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026796 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053064 | Gp0104120 | Ga0208943 |
| Sample Name | Rhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 19739258 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 3 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Rhizosphere → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → rhizosphere → soil |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Harvard Forest, Massachusetts, USA | |||||||
| Coordinates | Lat. (o) | 42.5502 | Long. (o) | -72.1737 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005160 | Metagenome / Metatranscriptome | 410 | Y |
| F020351 | Metagenome / Metatranscriptome | 224 | Y |
| F021008 | Metagenome / Metatranscriptome | 221 | Y |
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208943_100287 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| Ga0208943_100759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 542 | Open in IMG/M |
| Ga0208943_100886 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| Ga0208943_100901 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208943_100287 | Ga0208943_1002872 | F005160 | VPPASAILRLLVFAVPSARAAAGVQPLLGAATGVVQLRWALGLTAPAVVVAGLVFGAGRLFDRGDALQPPWYSAWVLFPGAFLLAGAAAMCIFGALTELSLIPPAMWTFLIAGSVLWAGAIVVVRSASR |
| Ga0208943_100759 | Ga0208943_1007592 | F020351 | MTEMVTSGSMSGERKRSDGLLGESDYERRRLLQAPPVLPATALLLDSTQLLVR |
| Ga0208943_100886 | Ga0208943_1008862 | F077438 | VYSTHRVEGSFTQSRLETLFLWNLQVEISSALRPKAEKEISSYKK |
| Ga0208943_100901 | Ga0208943_1009011 | F021008 | MTNAPSMKLLGLDHIGIVVRDIDETVSRARETVDGRPVGERFVAADIDLQALLCGESTLELIEV |
| ⦗Top⦘ |