NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026796

3300026796: Rhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026796 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053064 | Gp0104120 | Ga0208943
Sample NameRhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size19739258
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_211

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameRhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Rhizosphere → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomerhizospheresoil
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationHarvard Forest, Massachusetts, USA
CoordinatesLat. (o)42.5502Long. (o)-72.1737Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005160Metagenome / Metatranscriptome410Y
F020351Metagenome / Metatranscriptome224Y
F021008Metagenome / Metatranscriptome221Y
F077438Metagenome / Metatranscriptome117Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208943_100287All Organisms → cellular organisms → Bacteria640Open in IMG/M
Ga0208943_100759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21542Open in IMG/M
Ga0208943_100886All Organisms → cellular organisms → Bacteria529Open in IMG/M
Ga0208943_100901All Organisms → cellular organisms → Bacteria527Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208943_100287Ga0208943_1002872F005160VPPASAILRLLVFAVPSARAAAGVQPLLGAATGVVQLRWALGLTAPAVVVAGLVFGAGRLFDRGDALQPPWYSAWVLFPGAFLLAGAAAMCIFGALTELSLIPPAMWTFLIAGSVLWAGAIVVVRSASR
Ga0208943_100759Ga0208943_1007592F020351MTEMVTSGSMSGERKRSDGLLGESDYERRRLLQAPPVLPATALLLDSTQLLVR
Ga0208943_100886Ga0208943_1008862F077438VYSTHRVEGSFTQSRLETLFLWNLQVEISSALRPKAEKEISSYKK
Ga0208943_100901Ga0208943_1009011F021008MTNAPSMKLLGLDHIGIVVRDIDETVSRARETVDGRPVGERFVAADIDLQALLCGESTLELIEV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.