| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026364 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0131983 | Gp0291018 | Ga0247848 |
| Sample Name | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T50 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 27906201 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Peatland Microbial Communities From Stordalen Mire, Sweden |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → peatland → peat soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sweden: Norrbotten County, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3533 | Long. (o) | 19.0466 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074274 | Metagenome / Metatranscriptome | 119 | Y |
| F078013 | Metagenome | 117 | Y |
| F085859 | Metagenome | 111 | Y |
| F097738 | Metagenome / Metatranscriptome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0247848_100502 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae | 3485 | Open in IMG/M |
| Ga0247848_101453 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1567 | Open in IMG/M |
| Ga0247848_103863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| Ga0247848_106526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 537 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0247848_100502 | Ga0247848_1005021 | F085859 | WLIVLQTQGLSMTTQERKPKEPCFFTGQEALIYEVERACGQLNKLKELQLDEPFLRAVAAEIRAHMDHLGASLQDLTEPCG |
| Ga0247848_101453 | Ga0247848_1014531 | F078013 | MTRGIERDDCNIDNVDELHAMRDEALTNVKAPPPSEYDIAQFKEAFADNEEDSDYDRQERNAKQRALIWYSDTLYSASELLVIMPKVVPDYHEFDGSKTIQLLTSMYPEAYFLPGREYGVAIFIYPPNGTTALKKPNEIEMERLKANSYTIHVTQREGELIHVIELWFDXAEKLXHVEANAT |
| Ga0247848_103863 | Ga0247848_1038632 | F097738 | MPSSTMKPDPFYDRTRELAALDRAWTRHGNGGQMLLLYGRRRLGKT |
| Ga0247848_106526 | Ga0247848_1065262 | F074274 | MLYDFSMPIPERLNPTFDQTPSTLRLTEARQRLIVALDVPDAASAVA |
| ⦗Top⦘ |