NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026185

3300026185: Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_C_black_MG (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026185 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114514 | Gp0125930 | Ga0209949
Sample NameSalt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_C_black_MG (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size367086926
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana1
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulforapulum → Desulforapulum autotrophicum1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSalt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomewetland areasoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationSouth San Francisco, USA
CoordinatesLat. (o)37.4958Long. (o)-122.1331Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001506Metagenome / Metatranscriptome681Y
F005874Metagenome387Y
F011947Metagenome / Metatranscriptome285Y
F027186Metagenome / Metatranscriptome195Y
F056354Metagenome137N
F086685Metagenome110N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209949_1003339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7010Open in IMG/M
Ga0209949_1006866All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana4488Open in IMG/M
Ga0209949_1034438Not Available1571Open in IMG/M
Ga0209949_1059367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulforapulum → Desulforapulum autotrophicum1101Open in IMG/M
Ga0209949_1067685Not Available1009Open in IMG/M
Ga0209949_1121445Not Available682Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209949_1003339Ga0209949_100333914F001506TKKRKLSTRREGKPLQYPKPNEVVSKTFQIRYDKKLSPTAKLILNSFQNKYIYYAIDDILYSFKSNSRERENLLAILYSPVLSLQNNFSINFFDIWIHEIYIHEISKVNKFFKNDFSNFEQLNYITIKLLYKTRTPVKKLDSLW
Ga0209949_1006866Ga0209949_10068661F027186MTTNSNFNFIDNTAVTLELPFSEHIEELRQRVFLLFWVI
Ga0209949_1034438Ga0209949_10344383F005874MVEIPSVPPDDELSPQQLYDRVEQVTNLDADELRAFKQSDYNAAYLEVASDAAQPGDEPLDDAIRLLETPGYEYSAVDDGFNEVEEARELLDFQRRTQAQILSQGLGENFLTDAR
Ga0209949_1059367Ga0209949_10593671F011947VEAGSSELLDGHIIRYSRGSQFIVRLEDGREIKAIPLLEALEEAECSSASIINRRVQVRMCKHPKFHRIIKIGRPNQ
Ga0209949_1067685Ga0209949_10676853F086685MIELTTIPLVVWVIGCITFVILGHELTHYIAWLPVATSIEYHFEDQYIEAEYPDTPFARRWAAVAGISPVIVAIGLVLALMATGWNPTATWHHITASAAVVLYGISGGKSDFTALLALLRSRRSLG
Ga0209949_1121445Ga0209949_11214452F056354MILPVFIALSITAVVITGLAIRGDIPELLGAFVGAVMSIVAAINALDLIVITNSGNVKNLDPQVDIALVLLLIFIVNIIFIFDRAFSPGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.