3300025258: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300025258
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053073 | Gp0061139 | Ga0209129
• Sample Name: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 212076297
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter tataouinensis	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: University of North Carolina, USA
• Coordinates
  • Lat. (^o): 35.9082
  • Long. (^o): -79.0499
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033510	Metagenome / Metatranscriptome	177	Y
F074001	Metagenome / Metatranscriptome	120	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0209129_1019583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter tataouinensis	1276
Ga0209129_1032868	Not Available	856

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209129_1019583	Ga0209129_10195831	F074001	MTRNTSPAPLEQARSKTDQVQRDLEVASAELGLTHGALDRELPPDVKQGDVAWALRQNKKLERKVQQAAEELEEVTDLLDQAKAGGSGGDGRSRDPH
Ga0209129_1032868	Ga0209129_10328681	F033510	HEQLAAHDDKGERHVVMVTRAPVPSAPHLRGMPHYTWHDGQVLHLVDAKAGVLECAVTGQRLTIERWRG