NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300023038

3300023038: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung D2



Overview

Basic Information
IMG/M Taxon OID3300023038 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116274 | Gp0272173 | Ga0233370
Sample NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung D2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size82435090
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron1
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: California
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041521Metagenome159Y
F042737Metagenome / Metatranscriptome157Y
F062320Metagenome / Metatranscriptome130Y
F066313Metagenome126Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0233370_1008505All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides thetaiotaomicron1022Open in IMG/M
Ga0233370_1009650Not Available972Open in IMG/M
Ga0233370_1020088Not Available709Open in IMG/M
Ga0233370_1036049Not Available550Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0233370_1008505Ga0233370_10085052F041521GTFDAGEFRVDSGAGGFIGKIQENSSEVTIRNCAAYGTIKTNYAKNSFNNTPTIYMGGFLSFSNTGAKTTLENCLFAGKFEKGSNLTDEAFLGAFGTLRSVKAIKNCYYLADDGLAAVHSDSNLKPGSDNVEITAVTEDDLRNNTIATQLGTLWEQGENYPVIRR
Ga0233370_1009650Ga0233370_10096502F062320MKEFLEIMGKDIMSENFTRKKYVVYGIIAPLVLVLVCGLVGSLA
Ga0233370_1020088Ga0233370_10200882F042737MKLTEKSMEVYNYVKENGGRVSIEELAAGLNRTPRSVNANVTDLCSEKKGLAMREKVKGEGEDAKDITYVVLT
Ga0233370_1036049Ga0233370_10360491F066313MKEKIKEWMGKDNITFSAICGEKFTNSEVVYTHIGLVVFLLALGIVGGVE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.