| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300022918 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0290984 | Ga0247814 |
| Sample Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L179-409R-1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 760353071 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → plant litter |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041209 | Metagenome / Metatranscriptome | 160 | Y |
| F042607 | Metagenome | 158 | Y |
| F088701 | Metagenome / Metatranscriptome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0247814_10000267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 45724 | Open in IMG/M |
| Ga0247814_10061552 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 1681 | Open in IMG/M |
| Ga0247814_10287128 | Not Available | 625 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0247814_10000267 | Ga0247814_1000026739 | F042607 | MIIDNKKVDLTHDEEQMYKDICASYTGNGVKGEDLFFDLFETDDNGIIVFLKPPSKRQTSFEVFLFLMSVMQNQHIRAQYKVLDEAVDEIKNKIKEIDEKLAKL |
| Ga0247814_10061552 | Ga0247814_100615521 | F041209 | VSSAACEEIAELRRKLQRKRIGHVLFLDETALRLSAAPLRTLVLPHQQPYVVATETSTYAARFDMIACCTSDRVLIPKIFTPSERKGADVKGINGPMLKQFINDILAQAVEGLDRYPLTLVLDKAAIHKNTEALLQEFYDRGSQSIKEILLMPPNAAKRMSPLDNALFHDWKEECRKHPPATKKTIQRIMSDAWNKMKPKSHYKHCGLTRNVDPYFDCPAPDIHRHGS |
| Ga0247814_10287128 | Ga0247814_102871281 | F088701 | SSITLLTRKIKIWKTFVVAVVLKRPEKIPIPLFKNRKNKLSYAIKAEISKIVIVALEYKIDLSRLSVIELDKSKMINDIINT |
| ⦗Top⦘ |