NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022360

3300022360: Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.763 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300022360 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114516 | Gp0225757 | Ga0210373
Sample NameMetatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.763 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17427178
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEstuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Alternative Ecosystem Assignments
Environment Ontology (ENVO)estuarine biomeestuarysediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: Washington
CoordinatesLat. (o)46.302Long. (o)-123.036Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008361Metagenome / Metatranscriptome334Y
F027700Metagenome / Metatranscriptome193Y
F038082Metagenome / Metatranscriptome166Y
F042669Metagenome / Metatranscriptome157Y
F100417Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0210373_103844Not Available691Open in IMG/M
Ga0210373_105435Not Available611Open in IMG/M
Ga0210373_106276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium581Open in IMG/M
Ga0210373_109173All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris509Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0210373_103844Ga0210373_1038441F008361LSEAIKELEQATAAVENAETSKARLDASVELKKATARLEAVNYLS
Ga0210373_105435Ga0210373_1054351F027700DKAGISMIEDHPLNSPSHELKLHQLSARQERLLWHQRLGHCGDEQLSKAHEYCDGVPKISSKAKSVVDECHVCIAANMKARERGDGITRTATISGQGLSIDFSFAGQHSKNALNPERMHINDYMGLNGKTCYLLLYDHATERLSGVCKQSKAPPVNWLRRWLTNNVDKDVKG
Ga0210373_106276Ga0210373_1062762F100417SRLREKSAANFVAMLPVIEALLAGVAVGIINRFLARLEHECPDVSAAHRDDSDASTASSGTVEIPHFH
Ga0210373_109173Ga0210373_1091731F042669GTFCEEKVLLVRQVDDFAMGCKAESTARHVYDLVGTKLTLHNESEAPFEFLGLVDSFDGYDVLQTKHYIRLSAESYIRRLLKAHGWENPSPREESRKPKPPLHESDLAGMFNLAAGPKENTPEHKALAQHMGYGYRSVLGEILFAYVLCRPDIGYAVTTLAKFSTAPNE
Ga0210373_109295Ga0210373_1092951F038082KAFAYIITDYCTDGLKTRLAALPNFTTSIQDDPLALLKAIKTCVHENAVTQYPPVTIQQHWSRLLQLKQSSNEDPPTYAKRFEQQLETVKGYVGNTFTDGFAEHMPDYKANAYKHDAGKITALLATHVTDDAARQALATDLHDLFSHYKPKETQAQLDIKAQV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.