3300018544: Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0

Overview

Basic Information

• IMG/M Taxon OID: 3300018544
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0129055 | Gp0214185 | Ga0188857
• Sample Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0
• Sequencing Status: Permanent Draft
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1319541
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Metatranscriptome Of Marine Microbial Communities From Baltic Sea
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Baltic Sea
• Coordinates
  • Lat. (^o): 54.570232
  • Long. (^o): 11.332183
  • Alt. (m): N/A
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063493	Metagenome / Metatranscriptome	129	N
F078928	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0188857_100050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	920
Ga0188857_100059	Not Available	865

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0188857_100050	Ga0188857_1000502	F078928	AKRMIREAQKGKDEQMEDVYWDRMDTANRLADDCKARIQHIFNDTFGA
Ga0188857_100059	Ga0188857_1000592	F063493	MQTIFLIVLAVAIVGYLVMNREGLRWDRGFAGFRPAVTGVITEGNLEITGNPVEDVAIKALMIKKIVDATTEEIFRTKGLKMFPIETIFIQVFDSPDKIKELKQKRPDVYDAYVKFLQARDKDAVLTRNGDGTEQEQLARTALINYLEALKRDQDYNTVPDNVPATYRCRPIVSRITI