NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014940

3300014940: Human fecal microbial communities from infant at 12 months in Denmark - 626_12M



Overview

Basic Information
IMG/M Taxon OID3300014940 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127429 | Gp0193836 | Ga0169849
Sample NameHuman fecal microbial communities from infant at 12 months in Denmark - 626_12M
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size100003510
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationDenmark
CoordinatesLat. (o)55.678Long. (o)12.531Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026489Metagenome197N
F032286Metagenome / Metatranscriptome180Y
F068811Metagenome124N
F076190Metagenome118Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0169849_100117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae79527Open in IMG/M
Ga0169849_100243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae49466Open in IMG/M
Ga0169849_116593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii810Open in IMG/M
Ga0169849_124631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales590Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0169849_100117Ga0169849_10011714F076190VTTAGGSITISAKNVFTAASRVSGYVWSLVRITVPNGLKSVRIRGRKTQNNFLYPYFQREPL*
Ga0169849_100243Ga0169849_10024343F032286MRSMVKWVCQTVTSVRHRALVFNTWLFAGNAADDTLVTGGTFRFCRLMCLCVKRRNIMLNDKRRSLLNSALFRADNRTEQKTISLFSLALIFIFDFAALSERRSCPEDRSRRFVPVGTLTLSRSWRVLRWGTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNADFHAYGQDRKRAEI*
Ga0169849_116593Ga0169849_1165932F068811MDQDGSEHNICSNREGLCPGKEQHGASGRKKIFQHGKEPLRNKDSVSQYCNKKAAVSLILNENVSETLCIFSIDKTNCCRIK*
Ga0169849_124631Ga0169849_1246312F026489METAEGCSLLTPKENQKSASDFDALEPRKRGCSPLLTPKGWATPEKTEDLRLFGV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.