3300014857: Human bile duct microbial communities from gallstone patients in Hangzhou, China - B6_bile

Overview

Basic Information

• IMG/M Taxon OID: 3300014857
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121295 | Gp0151502 | Ga0134330
• Sample Name: Human bile duct microbial communities from gallstone patients in Hangzhou, China - B6_bile
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Institution of Radiation Medicine
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3468581
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Excretory System → Liver → Bile → Human Bile Duct → Human Bile Duct Microbial Communities From Gallstone Patients In Hangzhou, China

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: China: Hangzhou
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0134330_11095	Not Available	823

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134330_11095	Ga0134330_110951	F077438	THRVEPSFIQSSFETLFLWNFQVEISRDLTPILDMEISSY*