| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014574 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127568 | Gp0198141 | Ga0180011 |
| Sample Name | Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_S1_MetaG |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 36233086 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → planetary subsurface zone → groundwater |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Finland: the Olkiluoto Island | |||||||
| Coordinates | Lat. (o) | 61.2413 | Long. (o) | 21.4947 | Alt. (m) | N/A | Depth (m) | 420 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065251 | Metagenome / Metatranscriptome | 128 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0180011_101616 | All Organisms → cellular organisms → Archaea | 1514 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0180011_101616 | Ga0180011_1016161 | F065251 | MHLRSFKRGKKRYYFIAKSVRNGKKVIQKSILYLGTADTIYKKLLKVKNSKN* |
| ⦗Top⦘ |