| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014571 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151541 | Ga0134369 |
| Sample Name | Human fecal microbial communities from obese patients in Germany - AS60_0 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hohenheim |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 127675257 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct1h53 | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Obese Patients In Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081453 | Metagenome | 114 | N |
| F089005 | Metagenome | 109 | N |
| F090515 | Metagenome | 108 | N |
| F099406 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134369_100104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct1h53 | 123927 | Open in IMG/M |
| Ga0134369_100443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 37920 | Open in IMG/M |
| Ga0134369_100546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 31697 | Open in IMG/M |
| Ga0134369_129235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia | 537 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134369_100104 | Ga0134369_10010444 | F099406 | MAEVGYNSKFEGLEVDSRLENVVQAAPGTGSESGKGGLIPAPPAGSQDGNKTLLSNMTWGDHVTKQYVDDAVSAAGWKKQIVSKLPTVEEAKDNVMYLVKDDVASTETKNVYNEYILVTEGGGTKVLESLGMVSTGVDSGYLDLSIFSGNSGSLDENSFAKVLDAYNNNITLGKLDGDYYYLNYFLEGNDFENNFKLKIVFASFANIDSAVGASEYDIEIQVGTFVVIQDKTYKAMNNMVTLSNTILSYLNFMAMPPKVVTTLADLPKGAHNIIANVASATKLSMTVSSEDVGREWQVRVNNTTDTDITQPLPTSGRFQSMSGNSVVIPKISFIELSIWYINDKLVIRVGE* |
| Ga0134369_100443 | Ga0134369_10044351 | F089005 | LTKSKQCSIIALALLRLATSNEESKQALKVRRTLKIEQRENSKETRNDFEESSKNYSEMYTKKHQ |
| Ga0134369_100546 | Ga0134369_10054627 | F090515 | VTTCCKAGQKAALQGTAPGRVACLEFAGGEKRKTNIAADYAVKALAFTALLCRHIGSIRTFLKS* |
| Ga0134369_129235 | Ga0134369_1292351 | F081453 | MSPFFLLAGDNIIEKHISANPVCGTNIKAPEPAVKGTPQKQLRIP* |
| ⦗Top⦘ |