| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014563 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151590 | Ga0134418 |
| Sample Name | Human fecal microbial communities from obese patients in Germany - AS45_24 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hohenheim |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 104934089 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Herelleviridae → unclassified Herelleviridae → Herelleviridae sp. | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Obese Patients In Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042737 | Metagenome / Metatranscriptome | 157 | Y |
| F068811 | Metagenome | 124 | N |
| F078004 | Metagenome | 117 | N |
| F081453 | Metagenome | 114 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134418_1000939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Herelleviridae → unclassified Herelleviridae → Herelleviridae sp. | 12617 | Open in IMG/M |
| Ga0134418_1020312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 836 | Open in IMG/M |
| Ga0134418_1036912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 512 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134418_1000939 | Ga0134418_100093912 | F042737 | MQLTAKSNEVFEYLKNNGGKVSIEELANATGRSARSVGANVLDLTNKGLVVREKEEVEGAEKPVAYAILTDAGKTFVPSDDAE* |
| Ga0134418_1000983 | Ga0134418_10009836 | F078004 | LSSRNTDLLFRDLLFRKSSTGGLSAVAGSAALDIHMIRHTLVIAVINTFYRLTVDTDGMAWMRQGITERLSSLSLLRKALAAGAVTITGMLTSHHDVSLAAQTILIIGTIFHNTF* |
| Ga0134418_1020312 | Ga0134418_10203121 | F068811 | MDQDGSEHNICSNREGLCPGKEQHGASGWKKIFRHGKEPLRNKDSVSQYCNKKAAVSLILNENVSETLCIFSIDKTNCCRI* |
| Ga0134418_1036912 | Ga0134418_10369122 | F081453 | MSPFFLWIGENIVEKYISANPVCGTNIKAPEPAVKGTPGRKFM* |
| ⦗Top⦘ |