| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014538 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151624 | Ga0134452 |
| Sample Name | Human fecal microbial communities from obese patients in Germany - AS60_6 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hohenheim |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 87641835 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes timonensis | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Obese Patients In Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076064 | Metagenome | 118 | N |
| F076190 | Metagenome | 118 | Y |
| F105374 | Metagenome | 100 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134452_102665 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 3225 | Open in IMG/M |
| Ga0134452_104167 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes timonensis | 2144 | Open in IMG/M |
| Ga0134452_113143 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134452_102665 | Ga0134452_1026655 | F076064 | LKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY* |
| Ga0134452_104167 | Ga0134452_1041673 | F105374 | GFGYYFCTFRLILRPGFGAAENIRYLVLSKGVFAMKKRVALLVALCIWKVVAAQTPYGEMPERFRPDTLPCRLGGGVCFGMDGLDAAIPRGEGASSCRDPRVVFVAGDTLITFISVAGVANTALGDPVCRFYGRNVARVVSRTRRMTGGRMGAADNDFPDDPDFAELQGVVIENQRYPWESYAAGDSAYRLPVARSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP* |
| Ga0134452_113143 | Ga0134452_1131431 | F076190 | SRVSGRVWSLVRITVPNGLKSVKIGVEKPQNNTLYSYFQRELL* |
| ⦗Top⦘ |