Basic Information | |
---|---|
IMG/M Taxon OID | 3300014083 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118649 | Gp0138570 | Ga0120366 |
Sample Name | Fecal viral communites from wild urban brown rats in Berlin, Germany - Mu/10/1773 |
Sequencing Status | Permanent Draft |
Sequencing Center | Freie University Berlin |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 7119225 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Fecal Viral Communites From Wild Urban Brown Rats In Berlin, Germany |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Viral Communites From Wild Urban Brown Rats In Berlin, Germany |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Germany: Berlin | |||||||
Coordinates | Lat. (o) | 52.529611 | Long. (o) | 13.401343 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F048027 | Metagenome / Metatranscriptome | 148 | Y |
F057003 | Metagenome / Metatranscriptome | 137 | Y |
F082826 | Metagenome / Metatranscriptome | 113 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0120366_100125 | Not Available | 2021 | Open in IMG/M |
Ga0120366_100387 | Not Available | 1246 | Open in IMG/M |
Ga0120366_100399 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 1222 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0120366_100125 | Ga0120366_1001252 | F048027 | MEKSSTKKTLDLRVRQIAKNNSGKGIGMPNWFTLPQYKEKRLLHIDVCKKLTELSEANDNYPITYLVYFAVGKNAHRLPTFLGGYEKIDEKKANTIFSWLRLFANHNDNLSLFRNPNLAHALCRFYDKYSTRTKDFKDALSKYEKNPKVKNFDMVAKGLGIAKEKKADVEVEESVEMAAVMA* |
Ga0120366_100387 | Ga0120366_1003871 | F082826 | MSRYTIELNYNASISFEVEADNEGDALDKARDQAEEADIREFAIGHENESRVLRER* |
Ga0120366_100399 | Ga0120366_1003991 | F057003 | MPNFIDLSNLTYCGAEAQEIFSKDIYDIDLRQYGITFMDGVKGKVKLYNGEIGDAWQVYTCPFTPAGAASLAESFIEPAAIKVNQENCYDTFWNTFLVDQTEISLRGGIPQTFGDWYFGKLRQKMAKEYQEIFWQGDKARTASTKTYLKVTDGIEKKMSALPSGNKYTVSAFTVDNIIEQVEAIILKGIDVANAAEVDTEGYKVFMNHADVRVLEIALGKLCCGNSMNDRFANYGRENGRIFVMGYEIVPSMIGKNKVVFGPARNLVLGYDTFDSHIEYKLIDMRETTGDNMFRVLAISNIAVGVIMPELFVYGS* |
⦗Top⦘ |