| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013830 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118654 | Gp0138582 | Ga0120377 |
| Sample Name | Sheep rumen microbial communities from Wyoming, USA - O_aries_Con_1239 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Missouri |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 181596033 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Ruminant Gut Microbial Communities From Various Locations In Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 41.314168 | Long. (o) | -105.584589 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035626 | Metagenome / Metatranscriptome | 171 | Y |
| F067315 | Metagenome / Metatranscriptome | 125 | Y |
| F082826 | Metagenome / Metatranscriptome | 113 | Y |
| F097402 | Metagenome / Metatranscriptome | 104 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0120377_1002831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 10159 | Open in IMG/M |
| Ga0120377_1016792 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1561 | Open in IMG/M |
| Ga0120377_1031178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 844 | Open in IMG/M |
| Ga0120377_1038388 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78 | 691 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0120377_1002831 | Ga0120377_100283116 | F067315 | MNKLEDFSNWLQIFSFLILIEDFNNTDLMKYLAHQDDLLNKIIDQNNELITLLKGGK* |
| Ga0120377_1016792 | Ga0120377_10167921 | F082826 | MANKYTIEFNYNASIVVDVEGEFHDEGEALDKAREIAEDADINEFTIGEERESKILNVR |
| Ga0120377_1031178 | Ga0120377_10311782 | F097402 | MTNLDHIQSLIHHGAQLRGEDGSLTPLTKAFYHNAVEACHTGGYNAATYDLVLPGIDSELWLAIWKDGHADSGSPKSICACLAR* |
| Ga0120377_1038388 | Ga0120377_10383881 | F035626 | MAPLIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDRFEPQPSAPHCHDGHDLALLLDSALEAAPASASTLNSEPTAPIEDGRLDATSGAAIQTAIEPNTNPVLCEA |
| ⦗Top⦘ |